BLASTX nr result
ID: Glycyrrhiza24_contig00003875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00003875 (889 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK37379.1| unknown [Medicago truncatula] 57 2e-06 ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medi... 57 2e-06 gb|AFK42031.1| unknown [Medicago truncatula] 57 2e-06 ref|XP_003556389.1| PREDICTED: auxin-responsive protein IAA14-li... 55 6e-06 ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max] gi... 55 6e-06 >gb|AFK37379.1| unknown [Medicago truncatula] Length = 236 Score = 57.0 bits (136), Expect(2) = 2e-06 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 409 GGGGSEVETPRASTGKRGFSETVDLKLNLQS 317 GGGGSEVETPRAS GKRGFSETVDLKLNLQ+ Sbjct: 27 GGGGSEVETPRAS-GKRGFSETVDLKLNLQT 56 Score = 21.6 bits (44), Expect(2) = 2e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 536 TELCLGLP 513 TELCLGLP Sbjct: 13 TELCLGLP 20 >ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula] gi|355480854|gb|AES62057.1| Indoleacetic acid-induced-like protein [Medicago truncatula] Length = 236 Score = 57.0 bits (136), Expect(2) = 2e-06 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 409 GGGGSEVETPRASTGKRGFSETVDLKLNLQS 317 GGGGSEVETPRAS GKRGFSETVDLKLNLQ+ Sbjct: 27 GGGGSEVETPRAS-GKRGFSETVDLKLNLQT 56 Score = 21.6 bits (44), Expect(2) = 2e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 536 TELCLGLP 513 TELCLGLP Sbjct: 13 TELCLGLP 20 >gb|AFK42031.1| unknown [Medicago truncatula] Length = 214 Score = 57.0 bits (136), Expect(2) = 2e-06 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 409 GGGGSEVETPRASTGKRGFSETVDLKLNLQS 317 GGGGSEVETPRAS GKRGFSETVDLKLNLQ+ Sbjct: 27 GGGGSEVETPRAS-GKRGFSETVDLKLNLQT 56 Score = 21.6 bits (44), Expect(2) = 2e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 536 TELCLGLP 513 TELCLGLP Sbjct: 13 TELCLGLP 20 >ref|XP_003556389.1| PREDICTED: auxin-responsive protein IAA14-like [Glycine max] Length = 247 Score = 55.1 bits (131), Expect(2) = 6e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 409 GGGGSEVETPRASTGKRGFSETVDLKLNLQS 317 GGGG EVETPRA TGKRGFSETVDLKLNL S Sbjct: 34 GGGGGEVETPRA-TGKRGFSETVDLKLNLHS 63 Score = 21.6 bits (44), Expect(2) = 6e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 536 TELCLGLP 513 TELCLGLP Sbjct: 16 TELCLGLP 23 >ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max] gi|238058427|gb|ACR39367.1| Aux/IAA protein [Glycine max] Length = 239 Score = 55.1 bits (131), Expect(2) = 6e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 406 GGGSEVETPRASTGKRGFSETVDLKLNLQS 317 GGGSEVETPRA TGKRGFSETVDLKLNLQ+ Sbjct: 26 GGGSEVETPRA-TGKRGFSETVDLKLNLQT 54 Score = 21.6 bits (44), Expect(2) = 6e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 536 TELCLGLP 513 TELCLGLP Sbjct: 18 TELCLGLP 25