BLASTX nr result
ID: Glycyrrhiza24_contig00003429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00003429 (1071 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537765.1| PREDICTED: 50S ribosomal protein L12, chloro... 69 2e-09 ref|XP_003540558.1| PREDICTED: 50S ribosomal protein L12, chloro... 68 4e-09 ref|XP_004141094.1| PREDICTED: 50S ribosomal protein L12, chloro... 67 8e-09 ref|XP_002298536.1| predicted protein [Populus trichocarpa] gi|1... 67 8e-09 ref|XP_004142800.1| PREDICTED: 50S ribosomal protein L12, chloro... 67 1e-08 >ref|XP_003537765.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Glycine max] Length = 188 Score = 68.9 bits (167), Expect = 2e-09 Identities = 36/49 (73%), Positives = 37/49 (75%) Frame = -1 Query: 597 EEKTEFDVVIEEVPSNXXXXXXXXXXXITNLGLKEAKELIEGLPKKFKE 451 EEKTEFDVVIEEVPSN +TNL LKEAKELIEGLPKKFKE Sbjct: 116 EEKTEFDVVIEEVPSNARIAVIKAVRALTNLALKEAKELIEGLPKKFKE 164 >ref|XP_003540558.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Glycine max] Length = 190 Score = 67.8 bits (164), Expect = 4e-09 Identities = 35/49 (71%), Positives = 37/49 (75%) Frame = -1 Query: 597 EEKTEFDVVIEEVPSNXXXXXXXXXXXITNLGLKEAKELIEGLPKKFKE 451 EEKTEFDV+IEEVPSN +TNL LKEAKELIEGLPKKFKE Sbjct: 118 EEKTEFDVLIEEVPSNARIAVIKAVRALTNLALKEAKELIEGLPKKFKE 166 >ref|XP_004141094.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Cucumis sativus] Length = 191 Score = 67.0 bits (162), Expect = 8e-09 Identities = 35/49 (71%), Positives = 37/49 (75%) Frame = -1 Query: 597 EEKTEFDVVIEEVPSNXXXXXXXXXXXITNLGLKEAKELIEGLPKKFKE 451 EEKTEFDVVIEEVPSN +T+L LKEAKELIEGLPKKFKE Sbjct: 119 EEKTEFDVVIEEVPSNARIAVIKSVRALTSLALKEAKELIEGLPKKFKE 167 >ref|XP_002298536.1| predicted protein [Populus trichocarpa] gi|118483906|gb|ABK93843.1| unknown [Populus trichocarpa] gi|222845794|gb|EEE83341.1| predicted protein [Populus trichocarpa] Length = 187 Score = 67.0 bits (162), Expect = 8e-09 Identities = 35/49 (71%), Positives = 37/49 (75%) Frame = -1 Query: 597 EEKTEFDVVIEEVPSNXXXXXXXXXXXITNLGLKEAKELIEGLPKKFKE 451 EEKTEFDVVIEEVPSN +T+L LKEAKELIEGLPKKFKE Sbjct: 115 EEKTEFDVVIEEVPSNVRIAVIKSVRALTSLALKEAKELIEGLPKKFKE 163 >ref|XP_004142800.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Cucumis sativus] Length = 183 Score = 66.6 bits (161), Expect = 1e-08 Identities = 53/135 (39%), Positives = 57/135 (42%), Gaps = 2/135 (1%) Frame = -1 Query: 849 LHFPPTKTTTLSHRATRLRRIAAVS--EKVEKLGXXXXXXXXXXXXXXXXXXXXXXXXXX 676 L F PT R T LR IAAVS EK+EKLG Sbjct: 26 LSFRPTTLQFPYRRPTHLRPIAAVSAPEKIEKLGSDISSLTLEEARLLVDFLQDKLGVSA 85 Query: 675 XXXXXXXXXXXXXXXXXXXXXXXXXVEEKTEFDVVIEEVPSNXXXXXXXXXXXITNLGLK 496 EEKTEFDVVIE+VPSN +T+L LK Sbjct: 86 AAFAPAAVVAAPGGAVGGEAAAEAV-EEKTEFDVVIEDVPSNARIAVIKSVRAMTSLALK 144 Query: 495 EAKELIEGLPKKFKE 451 EAKELIEGLPKKFKE Sbjct: 145 EAKELIEGLPKKFKE 159