BLASTX nr result
ID: Glycyrrhiza24_contig00002511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00002511 (830 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529546.1| PREDICTED: two-component response regulator ... 61 3e-07 ref|XP_003550512.1| PREDICTED: two-component response regulator ... 60 8e-07 emb|CBI22927.3| unnamed protein product [Vitis vinifera] 59 1e-06 ref|XP_003533222.1| PREDICTED: two-component response regulator ... 57 5e-06 emb|CBL94183.1| putative type-b response regulator (sensor histi... 57 5e-06 >ref|XP_003529546.1| PREDICTED: two-component response regulator ARR2-like [Glycine max] Length = 679 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 MSALLKQQEGIGPADNEFDFDGYSLDNIPV 90 MSALLKQQEG+GP++NEFDFDGYSLDNIPV Sbjct: 650 MSALLKQQEGMGPSENEFDFDGYSLDNIPV 679 >ref|XP_003550512.1| PREDICTED: two-component response regulator ARR2-like [Glycine max] Length = 677 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 MSALLKQQEGIGPADNEFDFDGYSLDNIPV 90 M+ALLKQQEG+GPA+NEF+FDGYSLDNIPV Sbjct: 648 MTALLKQQEGMGPAENEFEFDGYSLDNIPV 677 >emb|CBI22927.3| unnamed protein product [Vitis vinifera] Length = 533 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 MSALLKQQEGIGPADNEFDFDGYSLDNIPV 90 MSALLKQQEGIGP + EFDFDGYS+DNIPV Sbjct: 504 MSALLKQQEGIGPVEGEFDFDGYSMDNIPV 533 >ref|XP_003533222.1| PREDICTED: two-component response regulator ARR2-like [Glycine max] Length = 673 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 MSALLKQQEGIGPADNEFDFDGYSLDNIPV 90 +SA LKQQEG+G A+NEFDFDGYSLDNIPV Sbjct: 644 VSAFLKQQEGVGTAENEFDFDGYSLDNIPV 673 >emb|CBL94183.1| putative type-b response regulator (sensor histidine kinase) [Malus x domestica] Length = 674 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/31 (87%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = +1 Query: 1 MSALLKQQE-GIGPADNEFDFDGYSLDNIPV 90 MSALLKQQ+ G+GPA+NEFDFDGYSLDNIPV Sbjct: 644 MSALLKQQQDGLGPAENEFDFDGYSLDNIPV 674