BLASTX nr result
ID: Glycyrrhiza24_contig00002453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00002453 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containi... 90 2e-16 ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containi... 90 2e-16 ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycin... 90 2e-16 ref|XP_002510894.1| conserved hypothetical protein [Ricinus comm... 90 2e-16 ref|XP_003563153.1| PREDICTED: CDGSH iron-sulfur domain-containi... 89 5e-16 >ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] gi|449506515|ref|XP_004162771.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] Length = 108 Score = 89.7 bits (221), Expect = 2e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 114 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK Sbjct: 71 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 108 >ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Glycine max] Length = 113 Score = 89.7 bits (221), Expect = 2e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 114 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK Sbjct: 76 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 113 >ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycine max] gi|255628565|gb|ACU14627.1| unknown [Glycine max] Length = 113 Score = 89.7 bits (221), Expect = 2e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 114 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK Sbjct: 76 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 113 >ref|XP_002510894.1| conserved hypothetical protein [Ricinus communis] gi|223550009|gb|EEF51496.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 89.7 bits (221), Expect = 2e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 114 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK Sbjct: 71 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 108 >ref|XP_003563153.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Brachypodium distachyon] Length = 114 Score = 88.6 bits (218), Expect = 5e-16 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 1 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 114 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLL+KK Sbjct: 77 LTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLVKK 114