BLASTX nr result
ID: Glycyrrhiza24_contig00001486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00001486 (745 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 117 3e-24 ref|XP_002531714.1| conserved hypothetical protein [Ricinus comm... 115 7e-24 ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like... 112 6e-23 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 112 8e-23 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 111 1e-22 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 117 bits (292), Expect = 3e-24 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 1/66 (1%) Frame = -3 Query: 674 MSDQCGNCDCASKSQCVKKGNNYALDIVETEKSYVETVVMDIPAAENDG-CKCGSSCACV 498 MS CGNCDCA KSQCVKKG++Y DIVETEKS+V T++MD+PAAE+DG CKCG+SC CV Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAAEHDGKCKCGASCTCV 60 Query: 497 NCTCGH 480 CTCGH Sbjct: 61 TCTCGH 66 >ref|XP_002531714.1| conserved hypothetical protein [Ricinus communis] gi|223528657|gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 115 bits (289), Expect = 7e-24 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 1/66 (1%) Frame = -3 Query: 674 MSDQCGNCDCASKSQCVKKGNNYALDIVETEKSYVETVVMDIPAAENDG-CKCGSSCACV 498 MS CGNCDCA KSQCVKKG++Y D+VETEKS V T+VM++PAAE+DG CKCG+SC CV Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADVVETEKSSVSTIVMEVPAAEHDGKCKCGASCTCV 60 Query: 497 NCTCGH 480 NCTCGH Sbjct: 61 NCTCGH 66 >ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like isoform 1 [Vitis vinifera] gi|225461449|ref|XP_002284975.1| PREDICTED: metallothionein-like protein-like isoform 3 [Vitis vinifera] gi|225461451|ref|XP_002284958.1| PREDICTED: metallothionein-like protein-like isoform 2 [Vitis vinifera] gi|225461453|ref|XP_002284978.1| PREDICTED: metallothionein-like protein-like isoform 4 [Vitis vinifera] gi|359493843|ref|XP_003634676.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|359493845|ref|XP_003634677.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|7406673|emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 112 bits (281), Expect = 6e-23 Identities = 47/61 (77%), Positives = 56/61 (91%), Gaps = 1/61 (1%) Frame = -3 Query: 662 CGNCDCASKSQCVKKGNNYALDIVETEKSYVETVVMDIPAAENDG-CKCGSSCACVNCTC 486 CGNCDCA KSQCVKKGN+Y +DIVETEKSYV TVVM++PAA+++G CKCG SCAC++CTC Sbjct: 4 CGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEVPAAQHEGSCKCGDSCACIDCTC 63 Query: 485 G 483 G Sbjct: 64 G 64 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 112 bits (280), Expect = 8e-23 Identities = 50/66 (75%), Positives = 56/66 (84%), Gaps = 1/66 (1%) Frame = -3 Query: 674 MSDQCGNCDCASKSQCVKKGNNYALDIVETEKSYVETVVMDIPAAENDG-CKCGSSCACV 498 MSD CGNCDCA K+QCVKKG++Y DI+ETEKS + TVVMD PAAENDG CKCG SC+C Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKS-IMTVVMDAPAAENDGKCKCGPSCSCT 59 Query: 497 NCTCGH 480 NCTCGH Sbjct: 60 NCTCGH 65 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 111 bits (278), Expect = 1e-22 Identities = 47/66 (71%), Positives = 54/66 (81%), Gaps = 1/66 (1%) Frame = -3 Query: 674 MSDQCGNCDCASKSQCVKKGNNYALDIVETEKSYVETVVMDIPAAENDG-CKCGSSCACV 498 MS CGNCDCA KSQCVKKG++Y DIVETEKS+V TVVM++PA E DG C+CG+ C C Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVPATEPDGKCRCGAGCTCT 60 Query: 497 NCTCGH 480 NCTCGH Sbjct: 61 NCTCGH 66