BLASTX nr result
ID: Glycyrrhiza24_contig00000728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00000728 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA18206.1| PSI type III chlorophyll a/b-binding protein [Ara... 68 7e-10 ref|NP_001031217.1| light-harvesting complex I chlorophyll a/b b... 68 7e-10 ref|NP_176347.1| light-harvesting complex I chlorophyll a/b bind... 68 7e-10 dbj|BAJ33764.1| unnamed protein product [Thellungiella halophila] 68 7e-10 ref|XP_002888084.1| hypothetical protein ARALYDRAFT_475174 [Arab... 68 7e-10 >gb|AAA18206.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] Length = 273 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 93 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 243 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|NP_001031217.1| light-harvesting complex I chlorophyll a/b binding protein 3 [Arabidopsis thaliana] gi|332195726|gb|AEE33847.1| light-harvesting complex I chlorophyll a/b binding protein 3 [Arabidopsis thaliana] Length = 218 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 93 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 188 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 218 >ref|NP_176347.1| light-harvesting complex I chlorophyll a/b binding protein 3 [Arabidopsis thaliana] gi|334183551|ref|NP_001185280.1| light-harvesting complex I chlorophyll a/b binding protein 3 [Arabidopsis thaliana] gi|4585882|gb|AAD25555.1|AC005850_12 PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|16649019|gb|AAL24361.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|20260044|gb|AAM13369.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|332195725|gb|AEE33846.1| light-harvesting complex I chlorophyll a/b binding protein 3 [Arabidopsis thaliana] gi|332195727|gb|AEE33848.1| light-harvesting complex I chlorophyll a/b binding protein 3 [Arabidopsis thaliana] Length = 273 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 93 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 243 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >dbj|BAJ33764.1| unnamed protein product [Thellungiella halophila] Length = 273 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 93 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 243 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|XP_002888084.1| hypothetical protein ARALYDRAFT_475174 [Arabidopsis lyrata subsp. lyrata] gi|297333925|gb|EFH64343.1| hypothetical protein ARALYDRAFT_475174 [Arabidopsis lyrata subsp. lyrata] Length = 273 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 93 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 243 GLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273