BLASTX nr result
ID: Glycyrrhiza24_contig00000491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00000491 (786 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528591.1| ATP binding protein, putative [Ricinus commu... 64 5e-08 >ref|XP_002528591.1| ATP binding protein, putative [Ricinus communis] gi|223531987|gb|EEF33799.1| ATP binding protein, putative [Ricinus communis] Length = 491 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 702 WRRRKGVNGILKEENGASPGPYRNLGSASFRSIEM 598 W+RR+GV GI +EENG SPGPY++LGSASFRSIEM Sbjct: 454 WKRRRGVKGIFEEENGVSPGPYKDLGSASFRSIEM 488