BLASTX nr result
ID: Glycyrrhiza23_contig00035103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00035103 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627939.1| Flavonol sulfotransferase-like protein [Medi... 55 2e-09 >ref|XP_003627939.1| Flavonol sulfotransferase-like protein [Medicago truncatula] gi|355521961|gb|AET02415.1| Flavonol sulfotransferase-like protein [Medicago truncatula] Length = 640 Score = 55.1 bits (131), Expect(2) = 2e-09 Identities = 26/52 (50%), Positives = 40/52 (76%), Gaps = 4/52 (7%) Frame = -3 Query: 226 LMLAWINHSLDPFIAQSVLWM*----VWDGLCERFYRRDIFWISESQEEI*T 83 ++++W+++S+DP I+QS+LWM +W+ L ERFY+ DIF IS+ QEEI T Sbjct: 78 MIMSWLSNSVDPQISQSILWMDTALEIWNELKERFYQGDIFRISDLQEEIYT 129 Score = 31.2 bits (69), Expect(2) = 2e-09 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = -1 Query: 339 VMVMALKFKNKFQFVNGSLPRP 274 V+ +AL+ K+K F+NG+LPRP Sbjct: 41 VLQVALRSKHKLHFINGALPRP 62