BLASTX nr result
ID: Glycyrrhiza23_contig00034951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00034951 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541796.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 ref|XP_003596227.1| Pentatricopeptide repeat-containing protein,... 55 4e-06 >ref|XP_003541796.1| PREDICTED: pentatricopeptide repeat-containing protein At1g53600, mitochondrial-like [Glycine max] Length = 713 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/68 (48%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Frame = -2 Query: 201 RQARSLHQRIANSTLSHYYSNLIRKHTHPA-KGKGSGSKYLTQYNTQISENGRNGDVRAA 25 + +R+LH+RI L + S L + H + + G GSK+L Q NTQI+ENGRNG+V+ A Sbjct: 3 QHSRTLHKRITKLNL--FQSKLNQSHNNDSINSGGKGSKFLIQCNTQIAENGRNGNVKEA 60 Query: 24 ETIFHRMP 1 E+IFH+MP Sbjct: 61 ESIFHKMP 68 >ref|XP_003596227.1| Pentatricopeptide repeat-containing protein, partial [Medicago truncatula] gi|355485275|gb|AES66478.1| Pentatricopeptide repeat-containing protein, partial [Medicago truncatula] Length = 402 Score = 55.5 bits (132), Expect = 4e-06 Identities = 33/69 (47%), Positives = 43/69 (62%) Frame = -2 Query: 210 MNCRQARSLHQRIANSTLSHYYSNLIRKHTHPAKGKGSGSKYLTQYNTQISENGRNGDVR 31 M AR++ QRI N T + T+ AKG SK++T+ N +ISENGRNG+V Sbjct: 1 MKFHYARNIQQRIINLT---------QNQTNIAKG----SKFITECNVKISENGRNGNVN 47 Query: 30 AAETIFHRM 4 AAETIF+RM Sbjct: 48 AAETIFNRM 56