BLASTX nr result
ID: Glycyrrhiza23_contig00034840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00034840 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617445.1| Glucan endo-1,3-beta-glucosidase-like protei... 56 3e-06 >ref|XP_003617445.1| Glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula] gi|355518780|gb|AET00404.1| Glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula] Length = 270 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/45 (66%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = +1 Query: 139 MERSIYYYVIFLLLVQVLCSGSSRTKKVVAPRHVNVLRR-ERKQK 270 M+RS+Y+Y IFLLL+Q+LCSGSSRT+K A R VNVL+R E KQ+ Sbjct: 1 MKRSVYHYAIFLLLIQILCSGSSRTEK-EAQREVNVLKRHEVKQE 44