BLASTX nr result
ID: Glycyrrhiza23_contig00034812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00034812 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597735.1| Pentatricopeptide repeat-containing protein ... 66 3e-09 ref|XP_003546945.1| PREDICTED: putative pentatricopeptide repeat... 65 4e-09 >ref|XP_003597735.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|87240430|gb|ABD32288.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355486783|gb|AES67986.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 620 Score = 66.2 bits (160), Expect = 3e-09 Identities = 42/82 (51%), Positives = 44/82 (53%), Gaps = 1/82 (1%) Frame = -1 Query: 244 MSFYSIKKTQEXXXXXXXXXXXXXXXXSYHSFATQQIPQHNPFPSKDQVDPFPPSPTS-Y 68 MSFYSIKKTQ YHS AT Q VD FPP PT+ Y Sbjct: 1 MSFYSIKKTQHTSFIFNLFPFSQSF---YHSLATHQTAS---------VDSFPPQPTTHY 48 Query: 67 CYTSLLQSCIAAKALRPGKQLH 2 YTSLLQSCI +KAL PGKQLH Sbjct: 49 GYTSLLQSCIDSKALNPGKQLH 70 >ref|XP_003546945.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Glycine max] Length = 631 Score = 65.5 bits (158), Expect = 4e-09 Identities = 42/88 (47%), Positives = 49/88 (55%), Gaps = 7/88 (7%) Frame = -1 Query: 244 MSFYSIKKTQEXXXXXXXXXXXXXXXXS------YHSFATQQIPQHNPFPSKDQVDPFPP 83 MSF SI+KTQE + SFATQ IPQH +VD FP Sbjct: 1 MSFSSIRKTQETSRILSILSFSLNLFPVSPYYFLHQSFATQLIPQH-------KVDSFPS 53 Query: 82 SPTS-YCYTSLLQSCIAAKALRPGKQLH 2 SP++ Y Y SLL+SCI+AKAL PGKQLH Sbjct: 54 SPSNHYYYASLLESCISAKALEPGKQLH 81