BLASTX nr result
ID: Glycyrrhiza23_contig00034623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00034623 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594869.1| Pentatricopeptide repeat-containing protein ... 68 7e-10 ref|XP_003533330.1| PREDICTED: putative pentatricopeptide repeat... 68 9e-10 ref|XP_003533328.1| PREDICTED: pentatricopeptide repeat-containi... 68 9e-10 ref|XP_003533312.1| PREDICTED: putative pentatricopeptide repeat... 68 9e-10 ref|XP_003549125.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 >ref|XP_003594869.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355483917|gb|AES65120.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 545 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYAVFEKDENYKAKKLVREMIVRGLL 215 +DNGCIPNA+TYE +I+++FEKDEN KA+KL+REMI RGLL Sbjct: 505 KDNGCIPNAITYEILIHSLFEKDENDKAEKLLREMIARGLL 545 >ref|XP_003533330.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Glycine max] Length = 546 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYAVFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA T+ETII A+F+KDEN KA+KL+R+MI RGLL Sbjct: 506 EDNGCIPNAFTFETIIIALFKKDENDKAEKLLRQMIARGLL 546 >ref|XP_003533328.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12775, mitochondrial-like [Glycine max] Length = 447 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYAVFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA T+ETII A+F+KDEN KA+KL+R+MI RGLL Sbjct: 407 EDNGCIPNAFTFETIIIALFKKDENDKAEKLLRQMIARGLL 447 >ref|XP_003533312.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Glycine max] Length = 546 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYAVFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA T+ETII A+F+KDEN KA+KL+R+MI RGLL Sbjct: 506 EDNGCIPNAFTFETIIIALFKKDENDKAEKLLRQMIARGLL 546 >ref|XP_003549125.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Glycine max] Length = 556 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYAVFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA+T++ II A+FEKDEN KA+KL+REMI RGLL Sbjct: 516 EDNGCIPNAITFDIIICALFEKDENDKAEKLLREMIARGLL 556