BLASTX nr result
ID: Glycyrrhiza23_contig00034456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00034456 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAU21499.2| oleosin 1 [Arachis hypogaea] gi|152032022|gb|ABS2... 90 2e-16 gb|AAK13450.1| oleosin variant B [Arachis hypogaea] 90 2e-16 gb|AAT11925.1| oleosin isoform [Arachis hypogaea] gi|86450991|gb... 88 6e-16 gb|ADD17087.1| putative oleosin [Trifolium repens] 88 8e-16 gb|AAK13449.1| oleosin variant A [Arachis hypogaea] 87 1e-15 >gb|AAU21499.2| oleosin 1 [Arachis hypogaea] gi|152032022|gb|ABS28870.1| oleosin 17.8 [Arachis hypogaea] Length = 169 Score = 89.7 bits (221), Expect = 2e-16 Identities = 46/73 (63%), Positives = 56/73 (76%), Gaps = 7/73 (9%) Frame = -1 Query: 382 SGACGVTGLMSFSWVANYVRERMWAGAVPETMDSAKQRMADMAGYVGQK-------TKEV 224 SGACG+TGL SFSWV NY+R+ G+VPE ++ AK RMAD+AGYVGQK TKEV Sbjct: 98 SGACGLTGLSSFSWVMNYIRQTH--GSVPEQLEMAKHRMADVAGYVGQKTKDVGQKTKEV 155 Query: 223 GQDIQTKAHEAKR 185 GQ+IQTKA ++KR Sbjct: 156 GQEIQTKAQDSKR 168 >gb|AAK13450.1| oleosin variant B [Arachis hypogaea] Length = 176 Score = 89.7 bits (221), Expect = 2e-16 Identities = 41/68 (60%), Positives = 56/68 (82%) Frame = -1 Query: 382 SGACGVTGLMSFSWVANYVRERMWAGAVPETMDSAKQRMADMAGYVGQKTKEVGQDIQTK 203 +GACG+TGLMS SW+ N++R+ + VP+ +DSAK+RMADMA YVGQKTK+ GQ+IQTK Sbjct: 109 AGACGLTGLMSLSWMINFIRQ-VHGTTVPDQLDSAKRRMADMADYVGQKTKDAGQEIQTK 167 Query: 202 AHEAKRNT 179 A + KR++ Sbjct: 168 AQDVKRSS 175 >gb|AAT11925.1| oleosin isoform [Arachis hypogaea] gi|86450991|gb|ABC96763.1| oleosin 5 [Arachis hypogaea] gi|152032024|gb|ABS28871.1| oleosin 18.5 [Arachis hypogaea] Length = 176 Score = 88.2 bits (217), Expect = 6e-16 Identities = 40/68 (58%), Positives = 55/68 (80%) Frame = -1 Query: 382 SGACGVTGLMSFSWVANYVRERMWAGAVPETMDSAKQRMADMAGYVGQKTKEVGQDIQTK 203 +GACG+TGLMS SW+ N++R+ + VP+ +DS K+RMADMA YVGQKTK+ GQ+IQTK Sbjct: 109 AGACGLTGLMSLSWMINFIRQ-VHGTTVPDQLDSVKRRMADMADYVGQKTKDAGQEIQTK 167 Query: 202 AHEAKRNT 179 A + KR++ Sbjct: 168 AQDVKRSS 175 >gb|ADD17087.1| putative oleosin [Trifolium repens] Length = 203 Score = 87.8 bits (216), Expect = 8e-16 Identities = 47/73 (64%), Positives = 52/73 (71%), Gaps = 7/73 (9%) Frame = -1 Query: 376 ACGVTGLMSFSWVANYVRERMWAGAVPETMDSAKQRMADMAGYVGQKTK-------EVGQ 218 ACG+TGLMS SW YVR+ VPE MDS K R+AD+A YVGQKTK EVGQ Sbjct: 133 ACGLTGLMSLSWTVKYVRDLQ--AVVPEQMDSMKGRVADVASYVGQKTKDVGQKTKEVGQ 190 Query: 217 DIQTKAHEAKRNT 179 DIQTKAHEAKR+T Sbjct: 191 DIQTKAHEAKRST 203 >gb|AAK13449.1| oleosin variant A [Arachis hypogaea] Length = 176 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/68 (58%), Positives = 54/68 (79%) Frame = -1 Query: 382 SGACGVTGLMSFSWVANYVRERMWAGAVPETMDSAKQRMADMAGYVGQKTKEVGQDIQTK 203 +GACG+TGLMS SW+ N++R+ + VP+ +DS K+RMADMA YVGQKTK+ GQ IQTK Sbjct: 109 AGACGLTGLMSLSWMINFIRQ-VHGTTVPDQLDSVKRRMADMADYVGQKTKDAGQQIQTK 167 Query: 202 AHEAKRNT 179 A + KR++ Sbjct: 168 AQDVKRSS 175