BLASTX nr result
ID: Glycyrrhiza23_contig00034269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00034269 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544429.1| PREDICTED: leucine-rich repeat receptor prot... 60 2e-07 ref|XP_003549419.1| PREDICTED: leucine-rich repeat receptor prot... 58 9e-07 ref|XP_002533279.1| serine-threonine protein kinase, plant-type,... 55 6e-06 >ref|XP_003544429.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Glycine max] Length = 636 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/53 (62%), Positives = 36/53 (67%) Frame = +2 Query: 8 ALQLVKLSLACLIQEPEGRPNMAEVVSGLLKIQRNDMHQKLSPSTNESLGMER 166 A QLVKL LACLIQEP RP M EVVS LLKI + M Q + PS + S MER Sbjct: 584 APQLVKLGLACLIQEPAERPTMVEVVSSLLKIYTSYMEQIIPPSISNSPSMER 636 >ref|XP_003549419.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Glycine max] Length = 633 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = +2 Query: 8 ALQLVKLSLACLIQEPEGRPNMAEVVSGLLKIQRNDMHQKLSPSTNESLGMER 166 ALQLVKL LACLIQE RP M EVVS LLK + M Q + PS + S MER Sbjct: 581 ALQLVKLGLACLIQESAERPTMVEVVSSLLKTYTSYMEQIIPPSISNSPSMER 633 >ref|XP_002533279.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526904|gb|EEF29111.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 617 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +2 Query: 2 ESALQLVKLSLACLIQEPEGRPNMAEVVSGLLKIQRNDMHQ 124 E L++VKLSLACL QEPE RP+MAE+VS LLKIQ D+H+ Sbjct: 575 EVVLRMVKLSLACLAQEPESRPSMAEIVSALLKIQL-DVHR 614