BLASTX nr result
ID: Glycyrrhiza23_contig00034178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00034178 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004164577.1| PREDICTED: formin-like protein 18-like [Cucu... 128 5e-28 ref|XP_004145586.1| PREDICTED: formin-like protein 18-like [Cucu... 128 5e-28 ref|XP_002283272.2| PREDICTED: uncharacterized protein LOC100249... 127 9e-28 ref|XP_003588832.1| Formin 2B [Medicago truncatula] gi|355477880... 127 9e-28 emb|CBI21133.3| unnamed protein product [Vitis vinifera] 127 9e-28 >ref|XP_004164577.1| PREDICTED: formin-like protein 18-like [Cucumis sativus] Length = 568 Score = 128 bits (321), Expect = 5e-28 Identities = 64/71 (90%), Positives = 66/71 (92%) Frame = +3 Query: 3 TLMHYLCKVLAEKLPELLDFPKDLVSLEGSTKIQLKYLAEEMQAISKGLEKVIQELIASE 182 TLMHYLCKVLAEKLPELLDFPKDLVSLE STKIQLKYLAEEMQAISKGLEKV+QEL SE Sbjct: 396 TLMHYLCKVLAEKLPELLDFPKDLVSLEASTKIQLKYLAEEMQAISKGLEKVVQELANSE 455 Query: 183 NDGSVSENFCR 215 NDG +SE FCR Sbjct: 456 NDGPISEIFCR 466 >ref|XP_004145586.1| PREDICTED: formin-like protein 18-like [Cucumis sativus] Length = 1396 Score = 128 bits (321), Expect = 5e-28 Identities = 64/71 (90%), Positives = 66/71 (92%) Frame = +3 Query: 3 TLMHYLCKVLAEKLPELLDFPKDLVSLEGSTKIQLKYLAEEMQAISKGLEKVIQELIASE 182 TLMHYLCKVLAEKLPELLDFPKDLVSLE STKIQLKYLAEEMQAISKGLEKV+QEL SE Sbjct: 1224 TLMHYLCKVLAEKLPELLDFPKDLVSLEASTKIQLKYLAEEMQAISKGLEKVVQELANSE 1283 Query: 183 NDGSVSENFCR 215 NDG +SE FCR Sbjct: 1284 NDGPISEIFCR 1294 >ref|XP_002283272.2| PREDICTED: uncharacterized protein LOC100249142 [Vitis vinifera] Length = 1187 Score = 127 bits (319), Expect = 9e-28 Identities = 63/71 (88%), Positives = 67/71 (94%) Frame = +3 Query: 3 TLMHYLCKVLAEKLPELLDFPKDLVSLEGSTKIQLKYLAEEMQAISKGLEKVIQELIASE 182 TLM+YLCKVLAEKLPELLDFPKDL+ LE STKIQLKYLAEEMQAISKGLEKV+QEL ASE Sbjct: 1011 TLMNYLCKVLAEKLPELLDFPKDLLHLEASTKIQLKYLAEEMQAISKGLEKVVQELTASE 1070 Query: 183 NDGSVSENFCR 215 NDG VSENFC+ Sbjct: 1071 NDGPVSENFCK 1081 >ref|XP_003588832.1| Formin 2B [Medicago truncatula] gi|355477880|gb|AES59083.1| Formin 2B [Medicago truncatula] Length = 1824 Score = 127 bits (319), Expect = 9e-28 Identities = 64/72 (88%), Positives = 68/72 (94%) Frame = +3 Query: 3 TLMHYLCKVLAEKLPELLDFPKDLVSLEGSTKIQLKYLAEEMQAISKGLEKVIQELIASE 182 TLMHYLCKVLAEKLPELLDF KDLV+LEG+TKIQLKYLAEEMQAISKGLEKVIQEL ASE Sbjct: 1648 TLMHYLCKVLAEKLPELLDFSKDLVNLEGATKIQLKYLAEEMQAISKGLEKVIQELSASE 1707 Query: 183 NDGSVSENFCRV 218 NDG VSE FC++ Sbjct: 1708 NDGPVSEVFCQI 1719 >emb|CBI21133.3| unnamed protein product [Vitis vinifera] Length = 1642 Score = 127 bits (319), Expect = 9e-28 Identities = 63/71 (88%), Positives = 67/71 (94%) Frame = +3 Query: 3 TLMHYLCKVLAEKLPELLDFPKDLVSLEGSTKIQLKYLAEEMQAISKGLEKVIQELIASE 182 TLM+YLCKVLAEKLPELLDFPKDL+ LE STKIQLKYLAEEMQAISKGLEKV+QEL ASE Sbjct: 1393 TLMNYLCKVLAEKLPELLDFPKDLLHLEASTKIQLKYLAEEMQAISKGLEKVVQELTASE 1452 Query: 183 NDGSVSENFCR 215 NDG VSENFC+ Sbjct: 1453 NDGPVSENFCK 1463