BLASTX nr result
ID: Glycyrrhiza23_contig00033995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033995 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626201.1| Pectinesterase [Medicago truncatula] gi|3555... 63 3e-08 >ref|XP_003626201.1| Pectinesterase [Medicago truncatula] gi|355501216|gb|AES82419.1| Pectinesterase [Medicago truncatula] Length = 146 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = +2 Query: 2 KNKEKERSKSHRHKRQKHSVKEVGHFFVPCFIVFHWLVYEIVWYSSSLKLLT 157 KNKEKERSKSHRHKR KHS+KEVGHFF +I +H ++++ + K+LT Sbjct: 97 KNKEKERSKSHRHKRHKHSLKEVGHFF--SYIAYHTGLFKLFVFFVLFKVLT 146