BLASTX nr result
ID: Glycyrrhiza23_contig00033968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033968 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627418.1| GDSL esterase/lipase [Medicago truncatula] g... 55 6e-06 >ref|XP_003627418.1| GDSL esterase/lipase [Medicago truncatula] gi|355521440|gb|AET01894.1| GDSL esterase/lipase [Medicago truncatula] Length = 377 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 8/77 (10%) Frame = +3 Query: 192 QDLHNRGAT*FAFFK--------SRSINKSEEYDSYLQELSSFASLHTQTLSVVRLQLEK 347 +++H RGA F I +S+ S L+ELSS AS+H Q L V L+L+K Sbjct: 211 KEIHKRGAKKFVILNLPPLGCLPGTRIIQSQGKGSCLEELSSLASIHNQALYEVLLELQK 270 Query: 348 RLRDFKISPYDFNANLT 398 +LR FK S YDFN++L+ Sbjct: 271 QLRGFKFSLYDFNSDLS 287