BLASTX nr result
ID: Glycyrrhiza23_contig00033831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033831 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595510.1| Replication protein A 70 kDa DNA-binding sub... 44 4e-06 >ref|XP_003595510.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] gi|355484558|gb|AES65761.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] Length = 549 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = +1 Query: 1 VTPRYCIKVRVHDATGDAIFVIFDRDGKELLNK 99 VTPRY IK+RV D T A FV+FDRD EL K Sbjct: 335 VTPRYMIKMRVVDHTDSATFVLFDRDAAELFKK 367 Score = 31.6 bits (70), Expect(2) = 4e-06 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +3 Query: 108 ELLEAEDKETGNHSIPKQICHLKGRSFLFKVEYKRPSNTNFEQSF 242 +++E+ T +PK I + +S+LFKVE S+T +E+S+ Sbjct: 371 DMIESCGMGTDASEVPKDILAMVEKSYLFKVETNLGSSTMYEKSY 415