BLASTX nr result
ID: Glycyrrhiza23_contig00033785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033785 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis ... 51 5e-07 >emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana] gi|7268307|emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana] Length = 929 Score = 51.2 bits (121), Expect(2) = 5e-07 Identities = 31/83 (37%), Positives = 43/83 (51%), Gaps = 1/83 (1%) Frame = +2 Query: 2 RLTDQLQYWNKNVFGNIFKRKHRLFRRLEGSNNRLLRAST-DLPVLRYQLW*EYCEITHQ 178 RL QL+ WNK VFGNI RK ++ L+ + L T DL + L E+ + HQ Sbjct: 87 RLRWQLKKWNKEVFGNIHVRKEKVVSDLKAVQDLLEVVQTDDLLMKEDTLLKEFDVLLHQ 146 Query: 179 EELYWLHHGKSKKISQGDLDTRF 247 EE W + K ++ GD +T F Sbjct: 147 EETLWFQKSREKLLALGDRNTTF 169 Score = 27.3 bits (59), Expect(2) = 5e-07 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 241 SFLHQSTLIRRRRNR 285 +F H ST+IRRRRNR Sbjct: 168 TFFHTSTVIRRRRNR 182