BLASTX nr result
ID: Glycyrrhiza23_contig00033779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033779 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003519572.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 79 4e-13 ref|XP_003544936.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 77 1e-12 ref|XP_003617524.1| ATP-dependent RNA helicase DBP4 [Medicago tr... 63 3e-08 >ref|XP_003519572.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32-like [Glycine max] Length = 746 Score = 79.0 bits (193), Expect = 4e-13 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = -1 Query: 324 IHRVGSTAYYKLDGKSVLLLLPSKIHMLEKLKVKKVPIHFNKPRKEL 184 IHRVG TA YK DGKSVL LLPS+I MLEKLK KVP+HFNKPRKEL Sbjct: 399 IHRVGRTARYKSDGKSVLFLLPSEIQMLEKLKAAKVPVHFNKPRKEL 445 >ref|XP_003544936.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32-like [Glycine max] Length = 743 Score = 77.4 bits (189), Expect = 1e-12 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -1 Query: 324 IHRVGSTAYYKLDGKSVLLLLPSKIHMLEKLKVKKVPIHFNKPRKEL 184 IHRVG TA YK DGKSVL LLPS+I MLEKLK KVP+HFNKPR+EL Sbjct: 398 IHRVGRTARYKSDGKSVLFLLPSEIQMLEKLKAAKVPVHFNKPRQEL 444 >ref|XP_003617524.1| ATP-dependent RNA helicase DBP4 [Medicago truncatula] gi|355518859|gb|AET00483.1| ATP-dependent RNA helicase DBP4 [Medicago truncatula] Length = 747 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/47 (68%), Positives = 34/47 (72%) Frame = -1 Query: 324 IHRVGSTAYYKLDGKSVLLLLPSKIHMLEKLKVKKVPIHFNKPRKEL 184 IHRVG TA Y GKSVL LLPS+ M EKLK KVP+H KPRKEL Sbjct: 408 IHRVGRTARYNSVGKSVLFLLPSETMMHEKLKAAKVPVHCQKPRKEL 454