BLASTX nr result
ID: Glycyrrhiza23_contig00033737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033737 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548173.1| PREDICTED: NAC domain-containing protein 43-... 55 4e-06 >ref|XP_003548173.1| PREDICTED: NAC domain-containing protein 43-like [Glycine max] Length = 443 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = -1 Query: 244 SSAAAYNISPAQDYTSEIDLWNFARXXXXXXXXSEPLCHVSNTSL 110 S A A+ P QD+TSEIDLWNF+R SEPLCHVSNTS+ Sbjct: 399 SPAPAFINPPTQDFTSEIDLWNFSRSTSSLLASSEPLCHVSNTSV 443