BLASTX nr result
ID: Glycyrrhiza23_contig00033732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033732 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540105.1| PREDICTED: TATA-binding protein-associated f... 96 4e-18 ref|XP_003534431.1| PREDICTED: TATA-binding protein-associated f... 96 4e-18 ref|XP_003534430.1| PREDICTED: TATA-binding protein-associated f... 96 4e-18 ref|XP_003633864.1| PREDICTED: TATA-binding protein-associated f... 94 9e-18 ref|XP_003633863.1| PREDICTED: TATA-binding protein-associated f... 94 9e-18 >ref|XP_003540105.1| PREDICTED: TATA-binding protein-associated factor 172-like [Glycine max] Length = 2047 Score = 95.5 bits (236), Expect = 4e-18 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGS QATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA Sbjct: 16 DTGSNQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 63 >ref|XP_003534431.1| PREDICTED: TATA-binding protein-associated factor 172-like isoform 2 [Glycine max] Length = 2064 Score = 95.5 bits (236), Expect = 4e-18 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYL SKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLHSKNWDTRVA 63 >ref|XP_003534430.1| PREDICTED: TATA-binding protein-associated factor 172-like isoform 1 [Glycine max] Length = 2047 Score = 95.5 bits (236), Expect = 4e-18 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYL SKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLHSKNWDTRVA 63 >ref|XP_003633864.1| PREDICTED: TATA-binding protein-associated factor 172 isoform 3 [Vitis vinifera] Length = 2060 Score = 94.4 bits (233), Expect = 9e-18 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDL SLL+KVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLNSLLRKVSQYLRSKNWDTRVA 63 >ref|XP_003633863.1| PREDICTED: TATA-binding protein-associated factor 172 isoform 2 [Vitis vinifera] Length = 2089 Score = 94.4 bits (233), Expect = 9e-18 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 145 DTGSTQATRLTAARQIGDIAKSHPQDLTSLLKKVSQYLRSKNWDTRVA 2 DTGSTQATRLTAARQIGDIAKSHPQDL SLL+KVSQYLRSKNWDTRVA Sbjct: 16 DTGSTQATRLTAARQIGDIAKSHPQDLNSLLRKVSQYLRSKNWDTRVA 63