BLASTX nr result
ID: Glycyrrhiza23_contig00033694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033694 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518769.1| PREDICTED: ureide permease 2-like [Glycine max] 74 9e-12 ref|XP_003614156.1| Ureide permease [Medicago truncatula] gi|355... 74 9e-12 ref|XP_003614097.1| Ureide permease [Medicago truncatula] gi|355... 73 2e-11 ref|XP_003614096.1| Ureide permease [Medicago truncatula] gi|355... 73 2e-11 ref|XP_003631196.1| PREDICTED: ureide permease 2-like [Vitis vin... 70 2e-10 >ref|XP_003518769.1| PREDICTED: ureide permease 2-like [Glycine max] Length = 395 Score = 74.3 bits (181), Expect = 9e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 266 LFGEYRKSSRRTYVLLGSMLLMFIAAVAILMASSGHRK 153 LFGEYRKSSRRTYVLLGSMLLMF+AAVA+LMASSGHRK Sbjct: 358 LFGEYRKSSRRTYVLLGSMLLMFVAAVAVLMASSGHRK 395 >ref|XP_003614156.1| Ureide permease [Medicago truncatula] gi|355515491|gb|AES97114.1| Ureide permease [Medicago truncatula] Length = 407 Score = 74.3 bits (181), Expect = 9e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 266 LFGEYRKSSRRTYVLLGSMLLMFIAAVAILMASSGHRK 153 LFGEYRKSSRRTY+LLGSMLLMFIAAVA+LMASSGHRK Sbjct: 368 LFGEYRKSSRRTYILLGSMLLMFIAAVAVLMASSGHRK 405 >ref|XP_003614097.1| Ureide permease [Medicago truncatula] gi|355515432|gb|AES97055.1| Ureide permease [Medicago truncatula] Length = 323 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 266 LFGEYRKSSRRTYVLLGSMLLMFIAAVAILMASSGHRK 153 LFGEYRKSSRRTY LLGSMLLMFIAAVA+LMASSGHRK Sbjct: 286 LFGEYRKSSRRTYTLLGSMLLMFIAAVAVLMASSGHRK 323 >ref|XP_003614096.1| Ureide permease [Medicago truncatula] gi|355515431|gb|AES97054.1| Ureide permease [Medicago truncatula] Length = 397 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 266 LFGEYRKSSRRTYVLLGSMLLMFIAAVAILMASSGHRK 153 LFGEYRKSSRRTY LLGSMLLMFIAAVA+LMASSGHRK Sbjct: 360 LFGEYRKSSRRTYTLLGSMLLMFIAAVAVLMASSGHRK 397 >ref|XP_003631196.1| PREDICTED: ureide permease 2-like [Vitis vinifera] Length = 397 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 266 LFGEYRKSSRRTYVLLGSMLLMFIAAVAILMASSGHRK 153 LFGEYRKSSRRTY+LLGSML MFIAAV ILM SSGHRK Sbjct: 359 LFGEYRKSSRRTYILLGSMLFMFIAAVGILMGSSGHRK 396