BLASTX nr result
ID: Glycyrrhiza23_contig00033509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033509 (196 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613544.1| Thioredoxin-2 [Medicago truncatula] gi|26931... 98 8e-19 ref|XP_003519128.1| PREDICTED: thioredoxin H2-like [Glycine max] 83 2e-14 ref|NP_001236052.1| uncharacterized protein LOC100527691 [Glycin... 82 6e-14 ref|XP_003551992.1| PREDICTED: thioredoxin H2-like [Glycine max] 80 2e-13 ref|NP_001238074.1| uncharacterized protein LOC100527572 [Glycin... 80 2e-13 >ref|XP_003613544.1| Thioredoxin-2 [Medicago truncatula] gi|269315886|gb|ACZ37069.1| thioredoxin h5 [Medicago truncatula] gi|355514879|gb|AES96502.1| Thioredoxin-2 [Medicago truncatula] Length = 126 Score = 97.8 bits (242), Expect = 8e-19 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -2 Query: 168 MGSNYFNFVYVDRSLESSNNILTFHSTAKWNAHFNAVKQTDKLMVLDFTAKWCGPC 1 M SN +NFVY+DRS ESS+ +LTFHSTAKWNAHF A K+T+KLMV+DFTAKWCGPC Sbjct: 1 MSSNLYNFVYIDRSTESSH-VLTFHSTAKWNAHFEAFKETNKLMVIDFTAKWCGPC 55 >ref|XP_003519128.1| PREDICTED: thioredoxin H2-like [Glycine max] Length = 127 Score = 83.2 bits (204), Expect = 2e-14 Identities = 35/56 (62%), Positives = 45/56 (80%) Frame = -2 Query: 168 MGSNYFNFVYVDRSLESSNNILTFHSTAKWNAHFNAVKQTDKLMVLDFTAKWCGPC 1 MG+ + F +V++S SS+ ILTFHSTAKW AHF+ K+T+KLMV+DFTA WCGPC Sbjct: 1 MGAKFSTFEFVEKSSHSSSLILTFHSTAKWKAHFDVSKETNKLMVIDFTATWCGPC 56 >ref|NP_001236052.1| uncharacterized protein LOC100527691 [Glycine max] gi|255632962|gb|ACU16835.1| unknown [Glycine max] Length = 126 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/56 (64%), Positives = 46/56 (82%) Frame = -2 Query: 168 MGSNYFNFVYVDRSLESSNNILTFHSTAKWNAHFNAVKQTDKLMVLDFTAKWCGPC 1 MG+N+ F +V++S SS +LTFHSTAKW AHF+A K+T+KLMV+DFTA WCGPC Sbjct: 1 MGANFSTFEFVEKSSHSSL-VLTFHSTAKWKAHFDASKETNKLMVIDFTATWCGPC 55 >ref|XP_003551992.1| PREDICTED: thioredoxin H2-like [Glycine max] Length = 121 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -2 Query: 141 YVDRSLESSNNILTFHSTAKWNAHFNAVKQTDKLMVLDFTAKWCGPC 1 YV RS ESS +L FHSTAKWNAHF+A+KQT+KLMV+DFTA WCGPC Sbjct: 5 YVARSSESSQ-VLNFHSTAKWNAHFDALKQTNKLMVVDFTASWCGPC 50 >ref|NP_001238074.1| uncharacterized protein LOC100527572 [Glycine max] gi|255632659|gb|ACU16681.1| unknown [Glycine max] Length = 121 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -2 Query: 141 YVDRSLESSNNILTFHSTAKWNAHFNAVKQTDKLMVLDFTAKWCGPC 1 YV RS ESS +LTFHSTAKWNAHF+A+KQ +KLMV+DFTA WCGPC Sbjct: 5 YVARSSESSQ-VLTFHSTAKWNAHFDALKQANKLMVVDFTASWCGPC 50