BLASTX nr result
ID: Glycyrrhiza23_contig00033507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033507 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534744.1| PREDICTED: pentatricopeptide repeat-containi... 100 9e-20 ref|XP_003547290.1| PREDICTED: pentatricopeptide repeat-containi... 95 7e-18 ref|XP_003534743.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 ref|XP_002269600.2| PREDICTED: pentatricopeptide repeat-containi... 87 1e-15 ref|XP_003547288.1| PREDICTED: pentatricopeptide repeat-containi... 87 1e-15 >ref|XP_003534744.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Glycine max] Length = 705 Score = 100 bits (250), Expect = 9e-20 Identities = 57/100 (57%), Positives = 69/100 (69%), Gaps = 6/100 (6%) Frame = -2 Query: 284 SHPNQASLQVADSHDP------VGKNKIWINPNSPRAKLLRKKLSGTSTNSFLVKLAESL 123 S +QA Q A SHDP + K +IW+NPNSPRAK L+ K S ++ S+L +L ESL Sbjct: 48 SKASQALHQDAASHDPDANSLSLSKTRIWVNPNSPRAKHLQPK-SPSARYSYLARLTESL 106 Query: 122 DSCDPTQPRVSAILNCLGDDVSERDAVLILDKMTNPETAP 3 +SC P+ VS IL L D+VSERDAV ILDKMTNPETAP Sbjct: 107 NSCTPSAQHVSTILKGLRDNVSERDAVFILDKMTNPETAP 146 >ref|XP_003547290.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Glycine max] Length = 692 Score = 94.7 bits (234), Expect = 7e-18 Identities = 53/102 (51%), Positives = 66/102 (64%), Gaps = 1/102 (0%) Frame = -2 Query: 308 PNFKFKTFSHPNQASLQVADSHDP-VGKNKIWINPNSPRAKLLRKKLSGTSTNSFLVKLA 132 P F + + A L D+ P + KN IW+NP SPRAK L+K S + +S L KLA Sbjct: 39 PRFSLQPVNTLQDAKLDDPDAKSPSLSKNSIWVNPRSPRAKHLQKN-SPHARSSSLTKLA 97 Query: 131 ESLDSCDPTQPRVSAILNCLGDDVSERDAVLILDKMTNPETA 6 +SLDSC+PT+ VS ILN L D+VSERDAV IL+ M NP TA Sbjct: 98 KSLDSCNPTEQHVSEILNVLRDNVSERDAVFILNTMVNPNTA 139 >ref|XP_003534743.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Glycine max] Length = 693 Score = 90.9 bits (224), Expect = 1e-16 Identities = 51/103 (49%), Positives = 68/103 (66%), Gaps = 2/103 (1%) Frame = -2 Query: 308 PNFKFKTFSH-PNQASLQVADSHDP-VGKNKIWINPNSPRAKLLRKKLSGTSTNSFLVKL 135 P F F+ F+ + A L D+ P + K W+NP SPRAK L++ S + +S L KL Sbjct: 39 PRFSFQPFNTLQDAAKLDDPDAKSPSLSKKSFWVNPRSPRAKQLQQN-SPHARSSSLTKL 97 Query: 134 AESLDSCDPTQPRVSAILNCLGDDVSERDAVLILDKMTNPETA 6 A+SLDSC+PT+ VS ILN LG++V+ERDAV IL+ M NP TA Sbjct: 98 AKSLDSCNPTEEHVSEILNVLGNNVAERDAVFILNTMANPNTA 140 >ref|XP_002269600.2| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Vitis vinifera] Length = 701 Score = 87.4 bits (215), Expect = 1e-15 Identities = 46/84 (54%), Positives = 60/84 (71%), Gaps = 2/84 (2%) Frame = -2 Query: 251 DSHDPVGKNK--IWINPNSPRAKLLRKKLSGTSTNSFLVKLAESLDSCDPTQPRVSAILN 78 +S DP K K IW+NP SPRA LR+ S + + LVK+AESLDSC+ T+ VS +L Sbjct: 77 NSQDPDRKTKSYIWVNPRSPRASKLRQH-SYDARYASLVKIAESLDSCEATEEDVSQVLR 135 Query: 77 CLGDDVSERDAVLILDKMTNPETA 6 CLGD + E+DAV++L+ MTNPETA Sbjct: 136 CLGDKILEQDAVIVLNNMTNPETA 159 >ref|XP_003547288.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Glycine max] Length = 706 Score = 87.4 bits (215), Expect = 1e-15 Identities = 52/108 (48%), Positives = 63/108 (58%), Gaps = 8/108 (7%) Frame = -2 Query: 305 NFKFKTFSHPNQASLQVADSH--------DPVGKNKIWINPNSPRAKLLRKKLSGTSTNS 150 +FK FS +Q + D+ P+ K IW+NP SPRAK L K S + +S Sbjct: 58 HFKLPNFSSSHQPKTLLQDAKLDDPNAKSSPLSKTSIWVNPKSPRAKHLWKN-SYHARSS 116 Query: 149 FLVKLAESLDSCDPTQPRVSAILNCLGDDVSERDAVLILDKMTNPETA 6 L KLA+SLDSC+PTQ VS IL LGD V E DAV IL+ M NP TA Sbjct: 117 SLTKLAKSLDSCNPTQEHVSEILKVLGDSVLEPDAVFILNSMVNPYTA 164