BLASTX nr result
ID: Glycyrrhiza23_contig00033483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033483 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528898.1| PREDICTED: glyoxylate reductase-like [Glycin... 88 8e-16 ref|XP_003528899.1| PREDICTED: glyoxylate reductase-like [Glycin... 60 2e-07 >ref|XP_003528898.1| PREDICTED: glyoxylate reductase-like [Glycine max] Length = 337 Score = 87.8 bits (216), Expect = 8e-16 Identities = 40/65 (61%), Positives = 47/65 (72%) Frame = -3 Query: 197 IAPNS*NSMAKEALPKVLVLGPPTCFATLEPLYSHKFHFLNHKPSGLPLHQFMESHRHHP 18 +A + NS + ALPKVLVLGPPTCF TL+PLYSHKFHFLN S L L F+ H HHP Sbjct: 1 MAEEAHNSNSMNALPKVLVLGPPTCFITLQPLYSHKFHFLNPHTSSLSLQHFLHHHHHHP 60 Query: 17 STIPA 3 S++ A Sbjct: 61 SSVSA 65 >ref|XP_003528899.1| PREDICTED: glyoxylate reductase-like [Glycine max] Length = 336 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -3 Query: 158 LPKVLVLGPPTCFATLEPLYSHKFHFLNHKPSGLPLHQFMESHRHHPSTIPA 3 LPKVL+ GPP + L+P +S KFH LNH S LPLH+F +H HH S++ A Sbjct: 19 LPKVLIHGPPGFSSVLQPPFSQKFHILNH--SSLPLHKFAATHAHHCSSVAA 68