BLASTX nr result
ID: Glycyrrhiza23_contig00033477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033477 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538647.1| PREDICTED: pentatricopeptide repeat-containi... 65 6e-09 >ref|XP_003538647.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22690-like [Glycine max] Length = 836 Score = 65.1 bits (157), Expect = 6e-09 Identities = 37/58 (63%), Positives = 40/58 (68%) Frame = +1 Query: 142 MATTLLHPSPVLLVPTSQKEPKAMTTTNPSPNNKSLVKNCKTLKELKQLHCDMMKKGL 315 MATTL PS LLVP S KE +T + S L+ NCKTLKELKQLHCDMMKKGL Sbjct: 1 MATTLF-PSSTLLVPASLKEANPITRNSSS----KLLVNCKTLKELKQLHCDMMKKGL 53