BLASTX nr result
ID: Glycyrrhiza23_contig00033454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033454 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524159.1| PREDICTED: two-component response regulator ... 74 2e-11 ref|XP_003532710.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 72 6e-11 ref|XP_003537547.1| PREDICTED: two-component response regulator ... 65 6e-09 ref|XP_003552793.1| PREDICTED: two-component response regulator ... 64 1e-08 ref|XP_003601849.1| Response regulator [Medicago truncatula] gi|... 63 2e-08 >ref|XP_003524159.1| PREDICTED: two-component response regulator ARR11-like [Glycine max] Length = 584 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 319 VDFGLQNIEMSQYYDPRLIAEVPTQLFDSADYSAVDQSLFIA 194 ++FGLQNI+MS+YYDPRLIAEVP+ +DSADYS+VDQSLFIA Sbjct: 543 MNFGLQNIDMSEYYDPRLIAEVPSHFYDSADYSSVDQSLFIA 584 >ref|XP_003532710.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR11-like [Glycine max] Length = 581 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -2 Query: 319 VDFGLQNIEMSQYYDPRLIAEVPTQLFDSADYSAVDQSLFIA 194 ++FGLQNI+MS+YYDPRL AEVP+ +DSADYS+VDQSLFIA Sbjct: 540 MNFGLQNIDMSEYYDPRLTAEVPSHFYDSADYSSVDQSLFIA 581 >ref|XP_003537547.1| PREDICTED: two-component response regulator ARR11-like [Glycine max] Length = 585 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 319 VDFGLQNIEMSQYYDPRLIAEVPTQLFDSADYSAVDQSLFIA 194 ++F LQNI MS+YYDP LI+E PT L+DSADYS +DQ LFIA Sbjct: 544 MNFSLQNIGMSEYYDPGLISEAPTHLYDSADYSVIDQGLFIA 585 >ref|XP_003552793.1| PREDICTED: two-component response regulator ARR11-like [Glycine max] Length = 557 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 319 VDFGLQNIEMSQYYDPRLIAEVPTQLFDSADYSAVDQSLFIA 194 ++FGLQNI MS+YYDP LI+E P L+DSADYS +DQ LFIA Sbjct: 516 MNFGLQNIGMSEYYDPGLISEAPIHLYDSADYSVMDQGLFIA 557 >ref|XP_003601849.1| Response regulator [Medicago truncatula] gi|355490897|gb|AES72100.1| Response regulator [Medicago truncatula] Length = 570 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -2 Query: 319 VDFGLQNIEMSQYYDPRLIAEVPTQLFDSADYSAVDQSLFIA 194 ++FG QNI MS+YYDP L+ EVP L+DSADYS +DQ LFIA Sbjct: 529 MNFGQQNIGMSEYYDPGLLIEVPNHLYDSADYSVIDQGLFIA 570