BLASTX nr result
ID: Glycyrrhiza23_contig00033367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033367 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524064.1| PREDICTED: pentatricopeptide repeat-containi... 68 7e-10 >ref|XP_003524064.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Glycine max] Length = 450 Score = 68.2 bits (165), Expect = 7e-10 Identities = 37/61 (60%), Positives = 49/61 (80%), Gaps = 2/61 (3%) Frame = -3 Query: 177 LLQAFAKLIILTSKPLVVHPHLYSIRRTLT--SSAKDEYFAAIQHVANIVRRDFYMERTL 4 +LQ +KLI+ SKP ++ +L+SI +TLT SS++DEYFA I HV+NIVRRDFY+ERTL Sbjct: 1 MLQTCSKLILRHSKPRLLL-NLHSITKTLTTASSSRDEYFAVIHHVSNIVRRDFYLERTL 59 Query: 3 N 1 N Sbjct: 60 N 60