BLASTX nr result
ID: Glycyrrhiza23_contig00033315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033315 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600580.1| Reticulon family protein [Medicago truncatul... 66 3e-09 >ref|XP_003600580.1| Reticulon family protein [Medicago truncatula] gi|355489628|gb|AES70831.1| Reticulon family protein [Medicago truncatula] Length = 247 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/46 (69%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = +3 Query: 3 DSDFLSN--KELDDDDSEFDCVFEKYFVFSAAKNRFFGRKRPLHAV 134 DSDFL N ++L DDDSEF+ VFE YF FS AKNRFF RK PLH V Sbjct: 12 DSDFLHNNKEQLTDDDSEFETVFENYFAFSVAKNRFFARKLPLHVV 57