BLASTX nr result
ID: Glycyrrhiza23_contig00033233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033233 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592778.1| Ribulose-1,5 bisphosphate carboxylase/oxygen... 73 3e-11 ref|XP_003592777.1| Ribulose-1,5 bisphosphate carboxylase/oxygen... 73 3e-11 ref|XP_003535783.1| PREDICTED: histone-lysine N-methyltransferas... 71 1e-10 ref|XP_002525071.1| Ribulose-1,5 bisphosphate carboxylase/oxygen... 56 3e-06 >ref|XP_003592778.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase [Medicago truncatula] gi|355481826|gb|AES63029.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase [Medicago truncatula] Length = 243 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/46 (78%), Positives = 37/46 (80%) Frame = -3 Query: 364 VQSLDFSSRCERHPVRRLMARDLLHGELRILKSASAWLENYCFSLT 227 + S D SS ER PVRR MARDLLHGEL ILKSAS WLENYCFSLT Sbjct: 198 LDSCDSSSSSERLPVRRQMARDLLHGELHILKSASTWLENYCFSLT 243 >ref|XP_003592777.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase [Medicago truncatula] gi|355481825|gb|AES63028.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase [Medicago truncatula] Length = 451 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/46 (78%), Positives = 37/46 (80%) Frame = -3 Query: 364 VQSLDFSSRCERHPVRRLMARDLLHGELRILKSASAWLENYCFSLT 227 + S D SS ER PVRR MARDLLHGEL ILKSAS WLENYCFSLT Sbjct: 406 LDSCDSSSSSERLPVRRQMARDLLHGELHILKSASTWLENYCFSLT 451 >ref|XP_003535783.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Glycine max] Length = 463 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = -3 Query: 364 VQSLDFSSRCERHPVRRLMARDLLHGELRILKSASAWLENYCFSLT 227 + SLD S C R VR+LMA+DLL GELRILKSASAWLENYCFS+T Sbjct: 418 IMSLDSLSLCGRFSVRKLMAQDLLQGELRILKSASAWLENYCFSMT 463 >ref|XP_002525071.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast precursor, putative [Ricinus communis] gi|223535652|gb|EEF37318.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast precursor, putative [Ricinus communis] Length = 456 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 343 SRCERHPVRRLMARDLLHGELRILKSASAWLENYCFSL 230 S C+R +RR MA DLL GELR+LKSASAWL+NYC SL Sbjct: 398 SICKRFALRRQMALDLLTGELRVLKSASAWLKNYCTSL 435