BLASTX nr result
ID: Glycyrrhiza23_contig00033087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033087 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL30359.1| RNA-directed DNA polymerase [Arachis hypogaea] 92 7e-22 gb|ABD28627.2| RNA-directed DNA polymerase (Reverse transcriptas... 95 1e-20 gb|AAD37019.2| putative non-LTR retrolelement reverse transcript... 87 1e-16 gb|ABW81176.1| non-LTR reverse transcriptase [Arabidopsis cebenn... 87 2e-15 emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis ... 76 2e-12 >gb|AEL30359.1| RNA-directed DNA polymerase [Arachis hypogaea] Length = 1613 Score = 92.4 bits (228), Expect(2) = 7e-22 Identities = 47/90 (52%), Positives = 60/90 (66%), Gaps = 1/90 (1%) Frame = -1 Query: 267 IFGNIFKHKCILEARMRGIQHTLEHSDFPNLAMLEGELHREYDEVLKQE-LLWYQKSREK 91 +FGNIF KC LE ++ +Q LE D L E +L +Y+ L QE LLW+QKS E+ Sbjct: 687 VFGNIFVKKCELEQQINYLQKRLEVVDSIYLRQKERQLLDDYNNTLVQEELLWFQKSIEQ 746 Query: 90 WVRFGDRNIKFFHTQTIIRRMRNKIQGMFI 1 WVRFGDRN +FFH QT+ RR NKI G+F+ Sbjct: 747 WVRFGDRNTRFFHIQTLARRKHNKIHGLFL 776 Score = 36.2 bits (82), Expect(2) = 7e-22 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 383 WLTHEQFPSMVQNAWHKGMHSITASLGSVRKDAQEFNSK 267 W TH + +V +W G I L V+K++ EFNSK Sbjct: 648 WATHPGYRDIVNQSWWSGNRGIHGKLSEVQKNSLEFNSK 686 >gb|ABD28627.2| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H [Medicago truncatula] Length = 1296 Score = 95.1 bits (235), Expect(2) = 1e-20 Identities = 45/85 (52%), Positives = 61/85 (71%), Gaps = 1/85 (1%) Frame = -1 Query: 267 IFGNIFKHKCILEARMRGIQHTLEHSDFPNLAMLEGELHREYDEVL-KQELLWYQKSREK 91 +FGNIF+ K +E R++G+Q LE D +LE EL EY+ +L ++E+LWYQKSRE+ Sbjct: 287 VFGNIFQRKSRVEWRLKGVQSYLERVDSYRHTLLEKELQDEYNHILFQEEMLWYQKSREQ 346 Query: 90 WVRFGDRNIKFFHTQTIIRRMRNKI 16 WV+ GD+N FFH QT+IRR NKI Sbjct: 347 WVKLGDKNTAFFHAQTVIRRKWNKI 371 Score = 29.3 bits (64), Expect(2) = 1e-20 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -2 Query: 383 WLTHEQFPSMVQNAWHKGMHSITASLGSVRKDAQEFN 273 W+ H + ++V+ +W H+ TASL V +++ FN Sbjct: 248 WIDHYDYGNVVKRSWSTHTHNPTASLIKVMENSIIFN 284 >gb|AAD37019.2| putative non-LTR retrolelement reverse transcriptase [Arabidopsis thaliana] Length = 855 Score = 87.4 bits (215), Expect(2) = 1e-16 Identities = 42/86 (48%), Positives = 60/86 (69%), Gaps = 1/86 (1%) Frame = -1 Query: 267 IFGNIFKHKCILEARMRGIQHTLEHSDFPNLAMLEGELHREYDEVLKQE-LLWYQKSREK 91 +FG++ + K L ++ +Q LE + NL E EL +E+D VL+QE +LW+QKSREK Sbjct: 701 VFGDVNRRKESLMNEIKVVQELLEINQTDNLLSKEEELIKEFDVVLEQEEVLWFQKSREK 760 Query: 90 WVRFGDRNIKFFHTQTIIRRMRNKIQ 13 WV GDRN K+FHT T++RR RN+I+ Sbjct: 761 WVELGDRNTKYFHTMTVVRRRRNRIE 786 Score = 23.9 bits (50), Expect(2) = 1e-16 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -2 Query: 383 WLTHEQFPSMVQNAWH 336 WLTH F ++Q +W+ Sbjct: 663 WLTHSGFKDLLQASWN 678 >gb|ABW81176.1| non-LTR reverse transcriptase [Arabidopsis cebennensis] Length = 464 Score = 86.7 bits (213), Expect = 2e-15 Identities = 42/86 (48%), Positives = 60/86 (69%), Gaps = 1/86 (1%) Frame = -1 Query: 267 IFGNIFKHKCILEARMRGIQHTLEHSDFPNLAMLEGELHREYDEVLKQE-LLWYQKSREK 91 +FGNI + K L ++ +Q LEH+ +L E L +E++ VL+QE ++W+QKSREK Sbjct: 257 VFGNIQQRKDKLVQEIQAVQDFLEHNQTDDLLNKEDVLIKEFEVVLEQEEIVWFQKSREK 316 Query: 90 WVRFGDRNIKFFHTQTIIRRMRNKIQ 13 W+ GDRN K+FHT TIIRR RN+I+ Sbjct: 317 WIALGDRNTKYFHTSTIIRRRRNQIE 342 >emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana] gi|7268307|emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana] Length = 929 Score = 76.3 bits (186), Expect = 2e-12 Identities = 40/86 (46%), Positives = 55/86 (63%), Gaps = 1/86 (1%) Frame = -1 Query: 267 IFGNIFKHKCILEARMRGIQHTLEHSDFPNLAMLEGELHREYDEVLKQE-LLWYQKSREK 91 +FGNI K + + ++ +Q LE +L M E L +E+D +L QE LW+QKSREK Sbjct: 99 VFGNIHVRKEKVVSDLKAVQDLLEVVQTDDLLMKEDTLLKEFDVLLHQEETLWFQKSREK 158 Query: 90 WVRFGDRNIKFFHTQTIIRRMRNKIQ 13 + GDRN FFHT T+IRR RN+I+ Sbjct: 159 LLALGDRNTTFFHTSTVIRRRRNRIE 184