BLASTX nr result
ID: Glycyrrhiza23_contig00033082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033082 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514156.1| pentatricopeptide repeat-containing protein,... 76 3e-12 ref|XP_003633097.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 emb|CBI27939.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_004158941.1| PREDICTED: putative pentatricopeptide repeat... 63 2e-08 ref|XP_004147002.1| PREDICTED: putative pentatricopeptide repeat... 63 2e-08 >ref|XP_002514156.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546612|gb|EEF48110.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 885 Score = 75.9 bits (185), Expect = 3e-12 Identities = 34/68 (50%), Positives = 47/68 (69%) Frame = -3 Query: 213 DCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPS 34 +C LNEG +IH + +KSG++P +H W+SL+N AKCG FA ++LV M E+ V S Sbjct: 102 ECASKGNLNEGTAIHGNVIKSGLEPDSHLWVSLINLYAKCGSLAFARKVLVGMRERDVVS 161 Query: 33 WTALIQGF 10 WTALI G+ Sbjct: 162 WTALIAGY 169 >ref|XP_003633097.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Vitis vinifera] Length = 1005 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/70 (47%), Positives = 46/70 (65%) Frame = -3 Query: 210 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 31 C LNEG +IH +KSG++P +H W SL+N AKCG +A ++ ++PE+ V SW Sbjct: 138 CASKGDLNEGKAIHGQVIKSGINPDSHLWNSLVNVYAKCGSANYACKVFGEIPERDVVSW 197 Query: 30 TALIQGFGAQ 1 TALI GF A+ Sbjct: 198 TALITGFVAE 207 >emb|CBI27939.3| unnamed protein product [Vitis vinifera] Length = 764 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/70 (47%), Positives = 46/70 (65%) Frame = -3 Query: 210 CTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPSW 31 C LNEG +IH +KSG++P +H W SL+N AKCG +A ++ ++PE+ V SW Sbjct: 201 CASKGDLNEGKAIHGQVIKSGINPDSHLWNSLVNVYAKCGSANYACKVFGEIPERDVVSW 260 Query: 30 TALIQGFGAQ 1 TALI GF A+ Sbjct: 261 TALITGFVAE 270 >ref|XP_004158941.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Cucumis sativus] Length = 1004 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/71 (39%), Positives = 44/71 (61%) Frame = -3 Query: 213 DCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPS 34 +C +L +IH +K ++P +H W+SL+N AKC + +A +L +MP++ V S Sbjct: 121 ECASKRSLGVAKAIHGLIVKDVINPDSHLWVSLVNVYAKCRYSAYARLVLAKMPDRDVVS 180 Query: 33 WTALIQGFGAQ 1 WTALIQG A+ Sbjct: 181 WTALIQGLVAE 191 >ref|XP_004147002.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Cucumis sativus] Length = 989 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/71 (39%), Positives = 44/71 (61%) Frame = -3 Query: 213 DCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAKCGFPTFAHQMLVQMPEQHVPS 34 +C +L +IH +K ++P +H W+SL+N AKC + +A +L +MP++ V S Sbjct: 121 ECASKRSLGVAKAIHGLIVKDVINPDSHLWVSLVNVYAKCRYSAYARLVLAKMPDRDVVS 180 Query: 33 WTALIQGFGAQ 1 WTALIQG A+ Sbjct: 181 WTALIQGLVAE 191