BLASTX nr result
ID: Glycyrrhiza23_contig00033065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00033065 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591875.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 107 7e-30 ref|XP_003608293.1| FBD-associated F-box protein [Medicago trunc... 96 2e-26 ref|XP_003606067.1| FBD-associated F-box protein [Medicago trunc... 96 2e-26 ref|XP_003628330.1| hypothetical protein MTR_8g052440 [Medicago ... 96 2e-26 ref|XP_003629672.1| F-box family protein [Medicago truncatula] g... 99 3e-26 >ref|XP_003591875.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355480923|gb|AES62126.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 702 Score = 107 bits (267), Expect(2) = 7e-30 Identities = 50/67 (74%), Positives = 56/67 (83%) Frame = -1 Query: 283 MESNVDKNDSKIWPDLLTKAFIDIMVDEVTKGNMPNGVFHSRTWTSMTARLNAATNRSFS 104 M SNVD +DS +WPDL+TKAFIDIMVDEVTKGNMPNGVFH+ TWTSMT RLN+ TNRS Sbjct: 436 MASNVDNSDSMLWPDLVTKAFIDIMVDEVTKGNMPNGVFHTSTWTSMTTRLNSITNRSHK 495 Query: 103 VKTTKAK 83 + KAK Sbjct: 496 KEQLKAK 502 Score = 48.1 bits (113), Expect(2) = 7e-30 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -2 Query: 99 KQLKQKMHRLRAMHREFSLLLQHTGFGWDAETN 1 +QLK KM RLRAM EF LLQ+TGF W+AETN Sbjct: 497 EQLKAKMDRLRAMFHEFYSLLQNTGFTWNAETN 529 >ref|XP_003608293.1| FBD-associated F-box protein [Medicago truncatula] gi|355509348|gb|AES90490.1| FBD-associated F-box protein [Medicago truncatula] Length = 798 Score = 95.9 bits (237), Expect(2) = 2e-26 Identities = 45/67 (67%), Positives = 55/67 (82%) Frame = -1 Query: 283 MESNVDKNDSKIWPDLLTKAFIDIMVDEVTKGNMPNGVFHSRTWTSMTARLNAATNRSFS 104 M +NVD DS +WP+L+TKAFI+IMVDEVTK NM NGVFH+ TWTSMTA+LN+ TN S+S Sbjct: 515 MTTNVDNCDSTLWPELVTKAFIEIMVDEVTKENMQNGVFHTGTWTSMTAKLNSTTNCSYS 574 Query: 103 VKTTKAK 83 + KAK Sbjct: 575 EEQLKAK 581 Score = 48.1 bits (113), Expect(2) = 2e-26 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -2 Query: 99 KQLKQKMHRLRAMHREFSLLLQHTGFGWDAETN 1 +QLK KMH LR+M EF LLQ+T FGW+AETN Sbjct: 576 EQLKAKMHSLRSMFHEFYSLLQNTEFGWNAETN 608 >ref|XP_003606067.1| FBD-associated F-box protein [Medicago truncatula] gi|355507122|gb|AES88264.1| FBD-associated F-box protein [Medicago truncatula] Length = 790 Score = 95.9 bits (237), Expect(2) = 2e-26 Identities = 45/67 (67%), Positives = 55/67 (82%) Frame = -1 Query: 283 MESNVDKNDSKIWPDLLTKAFIDIMVDEVTKGNMPNGVFHSRTWTSMTARLNAATNRSFS 104 M +NVD DS +WP+L+TKAFI+IMVDEVTK NM NGVFH+ TWTSMTA+LN+ TN S+S Sbjct: 507 MTTNVDNCDSTLWPELVTKAFIEIMVDEVTKENMQNGVFHTGTWTSMTAKLNSTTNCSYS 566 Query: 103 VKTTKAK 83 + KAK Sbjct: 567 EEQLKAK 573 Score = 48.1 bits (113), Expect(2) = 2e-26 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -2 Query: 99 KQLKQKMHRLRAMHREFSLLLQHTGFGWDAETN 1 +QLK KMH LR+M EF LLQ+T FGW+AETN Sbjct: 568 EQLKAKMHSLRSMFHEFYSLLQNTEFGWNAETN 600 >ref|XP_003628330.1| hypothetical protein MTR_8g052440 [Medicago truncatula] gi|355522352|gb|AET02806.1| hypothetical protein MTR_8g052440 [Medicago truncatula] Length = 284 Score = 95.9 bits (237), Expect(2) = 2e-26 Identities = 45/67 (67%), Positives = 55/67 (82%) Frame = -1 Query: 283 MESNVDKNDSKIWPDLLTKAFIDIMVDEVTKGNMPNGVFHSRTWTSMTARLNAATNRSFS 104 M +NVD DS +WP+L+TKAFI+IMVDEVTK NM NGVFH+ TWTSMTA+LN+ TN S+S Sbjct: 1 MTTNVDNCDSTLWPELVTKAFIEIMVDEVTKENMQNGVFHTGTWTSMTAKLNSTTNCSYS 60 Query: 103 VKTTKAK 83 + KAK Sbjct: 61 EEQLKAK 67 Score = 48.1 bits (113), Expect(2) = 2e-26 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -2 Query: 99 KQLKQKMHRLRAMHREFSLLLQHTGFGWDAETN 1 +QLK KMH LR+M EF LLQ+T FGW+AETN Sbjct: 62 EQLKAKMHSLRSMFHEFYSLLQNTEFGWNAETN 94 >ref|XP_003629672.1| F-box family protein [Medicago truncatula] gi|355523694|gb|AET04148.1| F-box family protein [Medicago truncatula] Length = 709 Score = 98.6 bits (244), Expect(2) = 3e-26 Identities = 45/65 (69%), Positives = 53/65 (81%) Frame = -1 Query: 277 SNVDKNDSKIWPDLLTKAFIDIMVDEVTKGNMPNGVFHSRTWTSMTARLNAATNRSFSVK 98 +NVD +DS WPD++TK FIDIMVDEVTKGNM NGVFH+RTWTSMT RLN+ TN S+ + Sbjct: 424 TNVDSSDSMFWPDIVTKTFIDIMVDEVTKGNMSNGVFHTRTWTSMTNRLNSITNCSYEEE 483 Query: 97 TTKAK 83 KAK Sbjct: 484 QLKAK 488 Score = 45.1 bits (105), Expect(2) = 3e-26 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = -2 Query: 99 KQLKQKMHRLRAMHREFSLLLQHTGFGWDAETN 1 +QLK KMH LRAM EF LLQ+ GF W++ETN Sbjct: 483 EQLKAKMHCLRAMFHEFYSLLQNVGFVWNSETN 515