BLASTX nr result
ID: Glycyrrhiza23_contig00032788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032788 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538668.1| PREDICTED: heat shock protein STI-like [Glyc... 58 7e-07 ref|XP_003517431.1| PREDICTED: heat shock protein STI-like [Glyc... 58 7e-07 ref|XP_004147938.1| PREDICTED: heat shock protein STI-like [Cucu... 57 1e-06 ref|XP_002509580.1| heat shock protein 70 (HSP70)-interacting pr... 57 1e-06 ref|XP_003569975.1| PREDICTED: heat shock protein STI-like [Brac... 57 2e-06 >ref|XP_003538668.1| PREDICTED: heat shock protein STI-like [Glycine max] Length = 585 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 60 KLSKIEECIKDCDKAV*RGRELRPDFKMIARAL*QK 167 ++ K EECIKDCDKAV RGRELR DFKMIARAL +K Sbjct: 303 EMGKYEECIKDCDKAVERGRELRSDFKMIARALTRK 338 >ref|XP_003517431.1| PREDICTED: heat shock protein STI-like [Glycine max] Length = 585 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 60 KLSKIEECIKDCDKAV*RGRELRPDFKMIARAL*QK 167 ++ K EECIKDCDKAV RGRELR DFKMIARAL +K Sbjct: 303 EMGKYEECIKDCDKAVERGRELRSDFKMIARALTRK 338 >ref|XP_004147938.1| PREDICTED: heat shock protein STI-like [Cucumis sativus] gi|449529664|ref|XP_004171818.1| PREDICTED: heat shock protein STI-like [Cucumis sativus] Length = 577 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 60 KLSKIEECIKDCDKAV*RGRELRPDFKMIARAL*QK*T 173 ++ K E+CIKDCDKAV RGRELR DFKMIARAL +K T Sbjct: 295 EMGKYEDCIKDCDKAVERGRELRSDFKMIARALTRKGT 332 >ref|XP_002509580.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223549479|gb|EEF50967.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Length = 578 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 60 KLSKIEECIKDCDKAV*RGRELRPDFKMIARAL*QK*T 173 ++ K E+CIKDCDKAV RGRELR DFKMIARAL +K T Sbjct: 296 EMGKYEDCIKDCDKAVERGRELRSDFKMIARALTRKGT 333 >ref|XP_003569975.1| PREDICTED: heat shock protein STI-like [Brachypodium distachyon] Length = 577 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 60 KLSKIEECIKDCDKAV*RGRELRPDFKMIARAL*QK*T 173 ++ K +ECIKDCDKAV RGRELR DFKM+ARAL +K T Sbjct: 295 EMGKYDECIKDCDKAVERGRELRADFKMVARALTRKGT 332