BLASTX nr result
ID: Glycyrrhiza23_contig00032773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032773 (366 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528183.1| PREDICTED: probable WRKY transcription facto... 55 6e-06 >ref|XP_003528183.1| PREDICTED: probable WRKY transcription factor 72-like [Glycine max] Length = 615 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = +3 Query: 219 DDENLPEQENIVAQEPPMTNIERSSVDAGPNASS--PKKEEVDELEKTKVE 365 D+E+ EQE IV QEPP++ ERS+V+AGPNASS K+E VDELE K E Sbjct: 24 DEEDRREQE-IVTQEPPLSTTERSTVEAGPNASSLTKKEEAVDELEVAKAE 73