BLASTX nr result
ID: Glycyrrhiza23_contig00032702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032702 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545228.1| PREDICTED: aspartic proteinase nepenthesin-1... 181 6e-44 ref|XP_003553140.1| PREDICTED: aspartic proteinase nepenthesin-2... 181 7e-44 ref|XP_003518501.1| PREDICTED: aspartic proteinase nepenthesin-2... 179 2e-43 ref|XP_002307559.1| predicted protein [Populus trichocarpa] gi|2... 176 2e-42 ref|XP_002520371.1| basic 7S globulin 2 precursor small subunit,... 173 2e-41 >ref|XP_003545228.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Glycine max] Length = 559 Score = 181 bits (459), Expect = 6e-44 Identities = 78/84 (92%), Positives = 82/84 (97%) Frame = +3 Query: 3 YFMDVFVGTPPKHFSLILDTGSDLNWIQCVPCHACFEQNGPYYDPRDSSSFKNISCHDQR 182 YFMDVFVGTPPKHFSLILDTGSDLNWIQCVPC ACFEQ+GPYYDP+DSSSF+NISCHD R Sbjct: 195 YFMDVFVGTPPKHFSLILDTGSDLNWIQCVPCIACFEQSGPYYDPKDSSSFRNISCHDPR 254 Query: 183 CQLVSSPDPPHPCKAENQSCPYFY 254 CQLVSSPDPP+PCKAENQSCPYFY Sbjct: 255 CQLVSSPDPPNPCKAENQSCPYFY 278 >ref|XP_003553140.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Glycine max] Length = 560 Score = 181 bits (458), Expect = 7e-44 Identities = 77/84 (91%), Positives = 80/84 (95%) Frame = +3 Query: 3 YFMDVFVGTPPKHFSLILDTGSDLNWIQCVPCHACFEQNGPYYDPRDSSSFKNISCHDQR 182 YFMDVFVGTPPKHFSLILDTGSDLNWIQCVPC+ACFEQNGPYYDP+DSSSFKNI+CHD R Sbjct: 195 YFMDVFVGTPPKHFSLILDTGSDLNWIQCVPCYACFEQNGPYYDPKDSSSFKNITCHDPR 254 Query: 183 CQLVSSPDPPHPCKAENQSCPYFY 254 CQLVSSPDPP PCK E QSCPYFY Sbjct: 255 CQLVSSPDPPQPCKGETQSCPYFY 278 >ref|XP_003518501.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Glycine max] Length = 561 Score = 179 bits (454), Expect = 2e-43 Identities = 77/84 (91%), Positives = 81/84 (96%) Frame = +3 Query: 3 YFMDVFVGTPPKHFSLILDTGSDLNWIQCVPCHACFEQNGPYYDPRDSSSFKNISCHDQR 182 YFMDVFVGTPPKHFSLILDTGSDLNWIQCVPC ACFEQ+GPYYDP+DSSSF+NISCHD R Sbjct: 197 YFMDVFVGTPPKHFSLILDTGSDLNWIQCVPCIACFEQSGPYYDPKDSSSFRNISCHDPR 256 Query: 183 CQLVSSPDPPHPCKAENQSCPYFY 254 CQLVS+PDPP PCKAENQSCPYFY Sbjct: 257 CQLVSAPDPPKPCKAENQSCPYFY 280 >ref|XP_002307559.1| predicted protein [Populus trichocarpa] gi|222857008|gb|EEE94555.1| predicted protein [Populus trichocarpa] Length = 455 Score = 176 bits (445), Expect = 2e-42 Identities = 73/84 (86%), Positives = 79/84 (94%) Frame = +3 Query: 3 YFMDVFVGTPPKHFSLILDTGSDLNWIQCVPCHACFEQNGPYYDPRDSSSFKNISCHDQR 182 YFMDVF+GTPPKH+SLILDTGSDLNWIQCVPCH CFEQNGPYYDP++SSSF+NI CHD R Sbjct: 90 YFMDVFIGTPPKHYSLILDTGSDLNWIQCVPCHDCFEQNGPYYDPKESSSFRNIGCHDPR 149 Query: 183 CQLVSSPDPPHPCKAENQSCPYFY 254 C LVSSPDPP PCKAENQ+CPYFY Sbjct: 150 CHLVSSPDPPLPCKAENQTCPYFY 173 >ref|XP_002520371.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus communis] gi|223540418|gb|EEF41987.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus communis] Length = 557 Score = 173 bits (438), Expect = 2e-41 Identities = 72/84 (85%), Positives = 78/84 (92%) Frame = +3 Query: 3 YFMDVFVGTPPKHFSLILDTGSDLNWIQCVPCHACFEQNGPYYDPRDSSSFKNISCHDQR 182 YFMDVF+GTPP+HFSLILDTGSDLNWIQCVPC+ CF QNGPYYDP++SSSFKNI CHD R Sbjct: 192 YFMDVFIGTPPRHFSLILDTGSDLNWIQCVPCYDCFVQNGPYYDPKESSSFKNIGCHDPR 251 Query: 183 CQLVSSPDPPHPCKAENQSCPYFY 254 C LVSSPDPP PCKAENQ+CPYFY Sbjct: 252 CHLVSSPDPPQPCKAENQTCPYFY 275