BLASTX nr result
ID: Glycyrrhiza23_contig00032666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032666 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN09044.1| Ribonuclease H [Medicago truncatula] 61 8e-08 gb|ABN08573.1| Ribonuclease H [Medicago truncatula] 61 8e-08 >gb|ABN09044.1| Ribonuclease H [Medicago truncatula] Length = 235 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/66 (40%), Positives = 41/66 (62%) Frame = -2 Query: 200 WDRGVSDLLCYCDSTSAIEAVLHPVPTAHAYAGLLRSIQDRLQRSWRVRLCHTFWEGNKS 21 WD G+ ++C+ DST+ ++ V + H Y L+ +I+ L+R W V L HT EGN + Sbjct: 135 WDIGIKHVVCHSDSTTVVDLVQKDLNVHHKYGNLIMAIKKLLRRDWVVSLRHTLCEGNAA 194 Query: 20 ADWLAK 3 AD+LAK Sbjct: 195 ADFLAK 200 >gb|ABN08573.1| Ribonuclease H [Medicago truncatula] Length = 147 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/63 (42%), Positives = 38/63 (60%) Frame = -2 Query: 191 GVSDLLCYCDSTSAIEAVLHPVPTAHAYAGLLRSIQDRLQRSWRVRLCHTFWEGNKSADW 12 G + ++CY DS I+ + PV H YA + +I D + W V+LCH+ EGN SAD+ Sbjct: 38 GCTYIICYSDSKGGIDILAKPVKKYHCYASAIANIIDLMNLEWEVKLCHSLREGNASADF 97 Query: 11 LAK 3 LAK Sbjct: 98 LAK 100