BLASTX nr result
ID: Glycyrrhiza23_contig00032640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032640 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003599983.1| Microtubule-associated protein TORTIFOLIA1 [... 71 1e-10 ref|XP_003599982.1| Microtubule-associated protein TORTIFOLIA1 [... 71 1e-10 ref|XP_003553106.1| PREDICTED: microtubule-associated protein TO... 69 5e-10 ref|XP_002281360.2| PREDICTED: microtubule-associated protein TO... 55 8e-06 emb|CBI26604.3| unnamed protein product [Vitis vinifera] 55 8e-06 >ref|XP_003599983.1| Microtubule-associated protein TORTIFOLIA1 [Medicago truncatula] gi|355489031|gb|AES70234.1| Microtubule-associated protein TORTIFOLIA1 [Medicago truncatula] Length = 479 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 294 EASTDTAEEWEGVPPDQLLLQLASAWEIDLQQHDK 190 +ASTDTAE WEGVPPDQLLLQLAS WEIDLQQHDK Sbjct: 445 DASTDTAEGWEGVPPDQLLLQLASGWEIDLQQHDK 479 >ref|XP_003599982.1| Microtubule-associated protein TORTIFOLIA1 [Medicago truncatula] gi|355489030|gb|AES70233.1| Microtubule-associated protein TORTIFOLIA1 [Medicago truncatula] Length = 924 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 294 EASTDTAEEWEGVPPDQLLLQLASAWEIDLQQHDK 190 +ASTDTAE WEGVPPDQLLLQLAS WEIDLQQHDK Sbjct: 890 DASTDTAEGWEGVPPDQLLLQLASGWEIDLQQHDK 924 >ref|XP_003553106.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Glycine max] Length = 923 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 294 EASTDTAEEWEGVPPDQLLLQLASAWEIDLQQHDK 190 EASTD AE WEGV PDQLLLQLASAWEIDLQQHDK Sbjct: 889 EASTDPAETWEGVQPDQLLLQLASAWEIDLQQHDK 923 >ref|XP_002281360.2| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Vitis vinifera] Length = 904 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 291 ASTDTAEEWEGVPPDQLLLQLASAWEIDLQQHDK 190 A+TD E+WEG PDQLLLQLASAW IDLQQ +K Sbjct: 871 ATTDPPEDWEGATPDQLLLQLASAWGIDLQQLEK 904 >emb|CBI26604.3| unnamed protein product [Vitis vinifera] Length = 641 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 291 ASTDTAEEWEGVPPDQLLLQLASAWEIDLQQHDK 190 A+TD E+WEG PDQLLLQLASAW IDLQQ +K Sbjct: 608 ATTDPPEDWEGATPDQLLLQLASAWGIDLQQLEK 641