BLASTX nr result
ID: Glycyrrhiza23_contig00032475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032475 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313440.1| predicted protein [Populus trichocarpa] gi|2... 75 7e-12 ref|XP_002298363.1| predicted protein [Populus trichocarpa] gi|2... 74 1e-11 ref|NP_190235.1| U-box domain-containing protein 13 [Arabidopsis... 72 6e-11 ref|XP_002877490.1| armadillo/beta-catenin repeat family protein... 72 6e-11 ref|XP_002283992.1| PREDICTED: U-box domain-containing protein 1... 72 6e-11 >ref|XP_002313440.1| predicted protein [Populus trichocarpa] gi|222849848|gb|EEE87395.1| predicted protein [Populus trichocarpa] Length = 663 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = -1 Query: 408 KENATSVLVHLCSGDPLHLSILSSHGVINPLLDLAENGSERGKRKASQLLELI 250 +ENA +VLVHLCSGD HL HGV+ PL+DLA+NG++RGKRKA QLLE I Sbjct: 579 RENAAAVLVHLCSGDQKHLVEAQEHGVMGPLVDLAQNGTDRGKRKAQQLLERI 631 >ref|XP_002298363.1| predicted protein [Populus trichocarpa] gi|222845621|gb|EEE83168.1| predicted protein [Populus trichocarpa] Length = 663 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = -1 Query: 408 KENATSVLVHLCSGDPLHLSILSSHGVINPLLDLAENGSERGKRKASQLLELI 250 +ENA +VLVHLCSGD H+ HGV+ PL+DLA+NG++RGKRKA QLLE I Sbjct: 579 RENAAAVLVHLCSGDQKHMVEAQEHGVMGPLVDLAQNGTDRGKRKAQQLLERI 631 >ref|NP_190235.1| U-box domain-containing protein 13 [Arabidopsis thaliana] gi|75266129|sp|Q9SNC6.1|PUB13_ARATH RecName: Full=U-box domain-containing protein 13; AltName: Full=Plant U-box protein 13 gi|6523054|emb|CAB62321.1| arm repeat containing protein homolog [Arabidopsis thaliana] gi|14596007|gb|AAK68731.1| arm repeat containing protein homolog [Arabidopsis thaliana] gi|22136270|gb|AAM91213.1| arm repeat containing protein homolog [Arabidopsis thaliana] gi|332644646|gb|AEE78167.1| U-box domain-containing protein 13 [Arabidopsis thaliana] Length = 660 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = -1 Query: 408 KENATSVLVHLCSGDPLHLSILSSHGVINPLLDLAENGSERGKRKASQLLELI 250 +ENA +VLVHLCSGDP HL G++ PL+DLA NG++RGKRKA+QLLE I Sbjct: 575 RENAAAVLVHLCSGDPQHLVEAQKLGLMGPLIDLAGNGTDRGKRKAAQLLERI 627 >ref|XP_002877490.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297323328|gb|EFH53749.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 660 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = -1 Query: 408 KENATSVLVHLCSGDPLHLSILSSHGVINPLLDLAENGSERGKRKASQLLELI 250 +ENA +VLVHLCSGDP HL G++ PL+DLA NG++RGKRKA+QLLE I Sbjct: 575 RENAAAVLVHLCSGDPQHLVEAQKLGLMGPLIDLAGNGTDRGKRKAAQLLERI 627 >ref|XP_002283992.1| PREDICTED: U-box domain-containing protein 13 [Vitis vinifera] Length = 682 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/54 (61%), Positives = 44/54 (81%) Frame = -1 Query: 408 KENATSVLVHLCSGDPLHLSILSSHGVINPLLDLAENGSERGKRKASQLLELIG 247 +ENA +VLVHLC+GD HL+ GV+ PL+DLA+NG++RGKRKA+QLLE +G Sbjct: 576 RENAAAVLVHLCAGDQHHLAEAQELGVMGPLVDLAQNGTDRGKRKAAQLLERMG 629