BLASTX nr result
ID: Glycyrrhiza23_contig00032455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032455 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608524.1| hypothetical protein MTR_4g097020 [Medicago ... 85 5e-15 >ref|XP_003608524.1| hypothetical protein MTR_4g097020 [Medicago truncatula] gi|355509579|gb|AES90721.1| hypothetical protein MTR_4g097020 [Medicago truncatula] Length = 70 Score = 85.1 bits (209), Expect = 5e-15 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 1/66 (1%) Frame = -3 Query: 305 HVVAMVVDGVSDFVKTLWSLQERRWSYTFDVVTSAAVSITMTFVLCLLSIHNRRQRRGGM 126 +VVAM+VD V+ FV T W+LQERRWS TF +V SA VS+TM FVLC LS +N QRRG + Sbjct: 5 NVVAMMVDSVTHFVNTRWALQERRWSNTFHIVMSATVSVTMPFVLCFLSAYNHMQRRGDI 64 Query: 125 V-FASF 111 V FASF Sbjct: 65 VFFASF 70