BLASTX nr result
ID: Glycyrrhiza23_contig00032446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032446 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534526.1| conserved hypothetical protein [Ricinus comm... 100 1e-19 ref|NP_001146539.1| nucleic acid binding protein [Zea mays] gi|2... 99 4e-19 gb|ACG33609.1| nucleic acid binding protein [Zea mays] 99 4e-19 ref|XP_002436771.1| hypothetical protein SORBIDRAFT_10g008490 [S... 98 6e-19 dbj|BAD37890.1| RNase H domain-containing protein-like [Oryza sa... 97 1e-18 >ref|XP_002534526.1| conserved hypothetical protein [Ricinus communis] gi|223525107|gb|EEF27856.1| conserved hypothetical protein [Ricinus communis] Length = 213 Score = 100 bits (249), Expect = 1e-19 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 91 PTLLQPRVVLYDGVCHLCHRGVKWVIRADKDRKIKFCCVQSKAAEPYL 234 PTLLQPRVV+YDGVCHLCHRGVKWVI+ADK RKIKFCC+QSKAAEPYL Sbjct: 70 PTLLQPRVVVYDGVCHLCHRGVKWVIKADKYRKIKFCCLQSKAAEPYL 117 >ref|NP_001146539.1| nucleic acid binding protein [Zea mays] gi|219887741|gb|ACL54245.1| unknown [Zea mays] gi|413952552|gb|AFW85201.1| nucleic acid binding protein [Zea mays] Length = 211 Score = 99.0 bits (245), Expect = 4e-19 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +1 Query: 91 PTLLQPRVVLYDGVCHLCHRGVKWVIRADKDRKIKFCCVQSKAAEPYL 234 PTLLQPRV++YDGVCHLCHRGVKWVIR DK KIKFCCVQSKAAEPYL Sbjct: 60 PTLLQPRVLIYDGVCHLCHRGVKWVIRTDKHAKIKFCCVQSKAAEPYL 107 >gb|ACG33609.1| nucleic acid binding protein [Zea mays] Length = 211 Score = 99.0 bits (245), Expect = 4e-19 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +1 Query: 91 PTLLQPRVVLYDGVCHLCHRGVKWVIRADKDRKIKFCCVQSKAAEPYL 234 PTLLQPRV++YDGVCHLCHRGVKWVIR DK KIKFCCVQSKAAEPYL Sbjct: 60 PTLLQPRVLIYDGVCHLCHRGVKWVIRTDKHAKIKFCCVQSKAAEPYL 107 >ref|XP_002436771.1| hypothetical protein SORBIDRAFT_10g008490 [Sorghum bicolor] gi|241914994|gb|EER88138.1| hypothetical protein SORBIDRAFT_10g008490 [Sorghum bicolor] Length = 219 Score = 98.2 bits (243), Expect = 6e-19 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +1 Query: 91 PTLLQPRVVLYDGVCHLCHRGVKWVIRADKDRKIKFCCVQSKAAEPYL 234 PT+LQPRV++YDGVCHLCHRGVKWVIRADK KI+FCCVQSKAAEPYL Sbjct: 68 PTVLQPRVLIYDGVCHLCHRGVKWVIRADKHAKIRFCCVQSKAAEPYL 115 >dbj|BAD37890.1| RNase H domain-containing protein-like [Oryza sativa Japonica Group] gi|125596632|gb|EAZ36412.1| hypothetical protein OsJ_20742 [Oryza sativa Japonica Group] Length = 209 Score = 97.1 bits (240), Expect = 1e-18 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = +1 Query: 91 PTLLQPRVVLYDGVCHLCHRGVKWVIRADKDRKIKFCCVQSKAAEPYL 234 PT+LQPRV++YDGVCHLCHRGVKWVI+ADK KI+FCCVQSKAAEPYL Sbjct: 59 PTVLQPRVLIYDGVCHLCHRGVKWVIKADKHAKIRFCCVQSKAAEPYL 106