BLASTX nr result
ID: Glycyrrhiza23_contig00032437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032437 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612556.1| hypothetical protein MTR_5g026380 [Medicago ... 50 8e-08 >ref|XP_003612556.1| hypothetical protein MTR_5g026380 [Medicago truncatula] gi|355513891|gb|AES95514.1| hypothetical protein MTR_5g026380 [Medicago truncatula] Length = 109 Score = 50.4 bits (119), Expect(2) = 8e-08 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +2 Query: 92 VSMEAERIAHWVKQESARI-DVSTINSILSDHKEKD 196 V++EA+R+ WVKQES+RI DVS I SILSD+KEKD Sbjct: 71 VNIEADRVVQWVKQESSRIDDVSAIKSILSDNKEKD 106 Score = 30.8 bits (68), Expect(2) = 8e-08 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 3 KNDEILSDMSTFSV 44 KNDEILSDMSTFSV Sbjct: 41 KNDEILSDMSTFSV 54