BLASTX nr result
ID: Glycyrrhiza23_contig00032405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032405 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532761.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-12 ref|XP_003629790.1| Pentatricopeptide repeat-containing protein ... 62 5e-08 ref|XP_003608008.1| Pentatricopeptide repeat-containing protein ... 62 5e-08 ref|XP_003608410.1| Pentatricopeptide repeat-containing protein ... 62 6e-08 >ref|XP_003532761.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Glycine max] Length = 785 Score = 77.4 bits (189), Expect = 1e-12 Identities = 41/48 (85%), Positives = 45/48 (93%), Gaps = 1/48 (2%) Frame = -2 Query: 166 VSASLSETTHN-VTVDGNAKICKFREMGDLRNAMELLTRSQRSELELH 26 VSA+LSETTHN VTVD NAKICKF EMGDLRNAM+LL+RSQRSELEL+ Sbjct: 11 VSATLSETTHNNVTVDKNAKICKFCEMGDLRNAMKLLSRSQRSELELN 58 >ref|XP_003629790.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523812|gb|AET04266.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 908 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -2 Query: 178 SLTCVSASLSETTHNVTVDGNAKICKFREMGDLRNAMELLTRSQRSELELH 26 S CVS S + TTH+VT + NAKI KF EMGDLRNA+ELLT+S+ EL L+ Sbjct: 45 STVCVSPSFTNTTHSVTQNQNAKINKFCEMGDLRNAIELLTKSKSYELGLN 95 >ref|XP_003608008.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355509063|gb|AES90205.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1183 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -2 Query: 178 SLTCVSASLSETTHNVTVDGNAKICKFREMGDLRNAMELLTRSQRSELELH 26 S CVS S + TTH+VT + NAKI KF EMGDLRNA+ELLT+S+ EL L+ Sbjct: 320 STVCVSPSFTNTTHSVTQNQNAKINKFCEMGDLRNAIELLTKSKSYELGLN 370 >ref|XP_003608410.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355509465|gb|AES90607.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 219 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -2 Query: 178 SLTCVSASLSETTHNVTVDGNAKICKFREMGDLRNAMELLTRSQRSELELH 26 S CVS S + TTH+VT + NAKI KF EMGDLRNA+ELLT+S+ EL L+ Sbjct: 46 STVCVSPSFTNTTHSVTQNQNAKINKFCEMGDLRNAIELLTKSKGYELGLN 96