BLASTX nr result
ID: Glycyrrhiza23_contig00032376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032376 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containi... 164 5e-39 emb|CBI18929.3| unnamed protein product [Vitis vinifera] 142 2e-32 ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containi... 142 2e-32 ref|XP_002301973.1| predicted protein [Populus trichocarpa] gi|2... 142 4e-32 ref|NP_173449.1| pentatricopeptide repeat-containing protein [Ar... 136 2e-30 >ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Glycine max] Length = 748 Score = 164 bits (416), Expect = 5e-39 Identities = 76/77 (98%), Positives = 77/77 (100%) Frame = +2 Query: 2 DKEQILCGHSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIFVRDT 181 DKEQILCGHSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREI+VRDT Sbjct: 672 DKEQILCGHSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIYVRDT 731 Query: 182 NRFHHFKDGVCSCGDFW 232 NRFHHFKDGVCSCGDFW Sbjct: 732 NRFHHFKDGVCSCGDFW 748 >emb|CBI18929.3| unnamed protein product [Vitis vinifera] Length = 387 Score = 142 bits (359), Expect = 2e-32 Identities = 65/77 (84%), Positives = 67/77 (87%) Frame = +2 Query: 2 DKEQILCGHSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIFVRDT 181 DKEQILCGHSEKLAVV GLLNT PG PLQVIKNLRIC DCH VIK IS E REIFVRDT Sbjct: 311 DKEQILCGHSEKLAVVFGLLNTPPGYPLQVIKNLRICGDCHVVIKFISSFERREIFVRDT 370 Query: 182 NRFHHFKDGVCSCGDFW 232 NRFHHFK+G CSCGD+W Sbjct: 371 NRFHHFKEGACSCGDYW 387 >ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] Length = 758 Score = 142 bits (359), Expect = 2e-32 Identities = 65/77 (84%), Positives = 67/77 (87%) Frame = +2 Query: 2 DKEQILCGHSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIFVRDT 181 DKEQILCGHSEKLAVV GLLNT PG PLQVIKNLRIC DCH VIK IS E REIFVRDT Sbjct: 682 DKEQILCGHSEKLAVVFGLLNTPPGYPLQVIKNLRICGDCHVVIKFISSFERREIFVRDT 741 Query: 182 NRFHHFKDGVCSCGDFW 232 NRFHHFK+G CSCGD+W Sbjct: 742 NRFHHFKEGACSCGDYW 758 >ref|XP_002301973.1| predicted protein [Populus trichocarpa] gi|222843699|gb|EEE81246.1| predicted protein [Populus trichocarpa] Length = 716 Score = 142 bits (357), Expect = 4e-32 Identities = 67/77 (87%), Positives = 68/77 (88%) Frame = +2 Query: 2 DKEQILCGHSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIFVRDT 181 DKEQILCGHSEKLAVVLGLLNT PG PLQVIKNLRIC DCHAVIK IS E REIFVRDT Sbjct: 640 DKEQILCGHSEKLAVVLGLLNTKPGFPLQVIKNLRICRDCHAVIKFISDFEKREIFVRDT 699 Query: 182 NRFHHFKDGVCSCGDFW 232 NRFH FK GVCSCGD+W Sbjct: 700 NRFHQFKGGVCSCGDYW 716 >ref|NP_173449.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806503|sp|Q9LNU6.2|PPR53_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g20230 gi|332191832|gb|AEE29953.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 760 Score = 136 bits (343), Expect = 2e-30 Identities = 62/77 (80%), Positives = 67/77 (87%) Frame = +2 Query: 2 DKEQILCGHSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIFVRDT 181 ++EQ+L GHSEKLAVV GLLNT G PLQVIKNLRIC DCHAVIK IS GREIF+RDT Sbjct: 684 EQEQMLWGHSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHAVIKFISSYAGREIFIRDT 743 Query: 182 NRFHHFKDGVCSCGDFW 232 NRFHHFKDG+CSCGDFW Sbjct: 744 NRFHHFKDGICSCGDFW 760