BLASTX nr result
ID: Glycyrrhiza23_contig00032238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032238 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003519043.1| PREDICTED: LOW QUALITY PROTEIN: protein kina... 144 1e-32 ref|XP_003517946.1| PREDICTED: LOW QUALITY PROTEIN: protein kina... 144 1e-32 ref|NP_001238650.1| protein kinase [Glycine max] gi|223452351|gb... 143 2e-32 ref|XP_003551977.1| PREDICTED: protein kinase 2B, chloroplastic-... 139 2e-31 ref|XP_003613630.1| Protein kinase 2B [Medicago truncatula] gi|8... 137 7e-31 >ref|XP_003519043.1| PREDICTED: LOW QUALITY PROTEIN: protein kinase 2B, chloroplastic-like [Glycine max] Length = 414 Score = 144 bits (362), Expect = 1e-32 Identities = 69/72 (95%), Positives = 70/72 (97%) Frame = +3 Query: 3 ASSLPTPRSEGEILSSPNLKAFTFNELRNATRNFRPDSLLGEGGFGYVYKGWIHEHTFTA 182 ASSLPTPRSEGEILSSPNLK FTFNEL+NATRNFRPDSLLGEGGFGYVYKGWI EHTFTA Sbjct: 44 ASSLPTPRSEGEILSSPNLKPFTFNELKNATRNFRPDSLLGEGGFGYVYKGWIDEHTFTA 103 Query: 183 SKPGSGMVVAVK 218 SKPGSGMVVAVK Sbjct: 104 SKPGSGMVVAVK 115 >ref|XP_003517946.1| PREDICTED: LOW QUALITY PROTEIN: protein kinase 2B, chloroplastic-like [Glycine max] Length = 422 Score = 144 bits (362), Expect = 1e-32 Identities = 69/72 (95%), Positives = 70/72 (97%) Frame = +3 Query: 3 ASSLPTPRSEGEILSSPNLKAFTFNELRNATRNFRPDSLLGEGGFGYVYKGWIHEHTFTA 182 ASSLPTPRSEGEILSSPNLK FTFNEL+NATRNFRPDSLLGEGGFGYVYKGWI EHTFTA Sbjct: 44 ASSLPTPRSEGEILSSPNLKPFTFNELKNATRNFRPDSLLGEGGFGYVYKGWIDEHTFTA 103 Query: 183 SKPGSGMVVAVK 218 SKPGSGMVVAVK Sbjct: 104 SKPGSGMVVAVK 115 >ref|NP_001238650.1| protein kinase [Glycine max] gi|223452351|gb|ACM89503.1| protein kinase [Glycine max] Length = 402 Score = 143 bits (360), Expect = 2e-32 Identities = 68/71 (95%), Positives = 70/71 (98%) Frame = +3 Query: 6 SSLPTPRSEGEILSSPNLKAFTFNELRNATRNFRPDSLLGEGGFGYVYKGWIHEHTFTAS 185 S+LPTPRSEGEILSSPNLKAFTFNEL+NATRNFRPDSLLGEGGFGYVYKGWI EHTFTAS Sbjct: 47 SNLPTPRSEGEILSSPNLKAFTFNELKNATRNFRPDSLLGEGGFGYVYKGWIDEHTFTAS 106 Query: 186 KPGSGMVVAVK 218 KPGSGMVVAVK Sbjct: 107 KPGSGMVVAVK 117 >ref|XP_003551977.1| PREDICTED: protein kinase 2B, chloroplastic-like [Glycine max] Length = 416 Score = 139 bits (350), Expect = 2e-31 Identities = 66/71 (92%), Positives = 69/71 (97%) Frame = +3 Query: 6 SSLPTPRSEGEILSSPNLKAFTFNELRNATRNFRPDSLLGEGGFGYVYKGWIHEHTFTAS 185 S+LPTPRSEGEILSSPNLKAFTFNEL+NATRNFRPDSLLGEGGFG+VYKGWI EHT TAS Sbjct: 61 SNLPTPRSEGEILSSPNLKAFTFNELKNATRNFRPDSLLGEGGFGFVYKGWIDEHTLTAS 120 Query: 186 KPGSGMVVAVK 218 KPGSGMVVAVK Sbjct: 121 KPGSGMVVAVK 131 >ref|XP_003613630.1| Protein kinase 2B [Medicago truncatula] gi|87241133|gb|ABD32991.1| Protein kinase [Medicago truncatula] gi|355514965|gb|AES96588.1| Protein kinase 2B [Medicago truncatula] Length = 410 Score = 137 bits (346), Expect = 7e-31 Identities = 65/72 (90%), Positives = 70/72 (97%) Frame = +3 Query: 3 ASSLPTPRSEGEILSSPNLKAFTFNELRNATRNFRPDSLLGEGGFGYVYKGWIHEHTFTA 182 +S LPTPRSEGEILSSPNLKAF+FNEL+NATRNFRPDSLLGEGGFG+VYKGWI EHTFTA Sbjct: 43 SSLLPTPRSEGEILSSPNLKAFSFNELKNATRNFRPDSLLGEGGFGHVYKGWIDEHTFTA 102 Query: 183 SKPGSGMVVAVK 218 +KPGSGMVVAVK Sbjct: 103 AKPGSGMVVAVK 114