BLASTX nr result
ID: Glycyrrhiza23_contig00032198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032198 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637624.1| Methyl binding domain protein [Medicago trun... 84 9e-15 ref|XP_004158345.1| PREDICTED: methyl-CpG-binding domain-contain... 59 4e-07 ref|XP_004141185.1| PREDICTED: methyl-CpG-binding domain-contain... 59 5e-07 >ref|XP_003637624.1| Methyl binding domain protein [Medicago truncatula] gi|355503559|gb|AES84762.1| Methyl binding domain protein [Medicago truncatula] Length = 240 Score = 84.3 bits (207), Expect = 9e-15 Identities = 46/64 (71%), Positives = 48/64 (75%), Gaps = 1/64 (1%) Frame = -1 Query: 191 ELTDSTGGDRNLNAPPPPQQHQQ-DSRSGLGIDLNEIPSPSSSFAETLPDSAIDIVRAYH 15 ELTDST NL PPP Q QQ D+RS L IDLNEIPSPSSSF ETLPD +DIVR YH Sbjct: 3 ELTDSTAAGNNL--PPPQQPPQQIDTRSILCIDLNEIPSPSSSFVETLPDFTVDIVRTYH 60 Query: 14 ENPA 3 ENPA Sbjct: 61 ENPA 64 >ref|XP_004158345.1| PREDICTED: methyl-CpG-binding domain-containing protein 9-like [Cucumis sativus] Length = 1028 Score = 58.9 bits (141), Expect = 4e-07 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 2/66 (3%) Frame = -1 Query: 197 IMELTDSTGGDRNLNAPPPPQQHQQDSRSG--LGIDLNEIPSPSSSFAETLPDSAIDIVR 24 +MEL DS+ LN P P S +G +GIDLNEIPSPSS F+ETL DS D+VR Sbjct: 111 MMELADSSDEHPQLNHLPNPTDSTTRSATGTGIGIDLNEIPSPSS-FSETLSDS-FDVVR 168 Query: 23 AYHENP 6 +H+NP Sbjct: 169 TFHDNP 174 >ref|XP_004141185.1| PREDICTED: methyl-CpG-binding domain-containing protein 9-like [Cucumis sativus] Length = 2131 Score = 58.5 bits (140), Expect = 5e-07 Identities = 35/65 (53%), Positives = 42/65 (64%), Gaps = 2/65 (3%) Frame = -1 Query: 194 MELTDSTGGDRNLNAPPPPQQHQQDSRSG--LGIDLNEIPSPSSSFAETLPDSAIDIVRA 21 MEL DS+ LN P P S +G +GIDLNEIPSPSS F+ETL DS D+VR Sbjct: 1 MELADSSDEHPQLNHLPNPTDSTTRSATGTGIGIDLNEIPSPSS-FSETLSDS-FDVVRT 58 Query: 20 YHENP 6 +H+NP Sbjct: 59 FHDNP 63