BLASTX nr result
ID: Glycyrrhiza23_contig00032129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032129 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627466.1| hypothetical protein MTR_8g023390 [Medicago ... 56 3e-06 >ref|XP_003627466.1| hypothetical protein MTR_8g023390 [Medicago truncatula] gi|355521488|gb|AET01942.1| hypothetical protein MTR_8g023390 [Medicago truncatula] Length = 163 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 282 KERRPTCGLLTVTNLFSKSTKREEIPFPYLSLHQQNSPPAVQIYGPLYVVT 130 K++ P G L +T+LF + + EE PY++LHQQN+P VQ YGPLYVVT Sbjct: 114 KQKNPFSGPL-ITSLFKPTKRSEENEIPYMTLHQQNNPHPVQNYGPLYVVT 163