BLASTX nr result
ID: Glycyrrhiza23_contig00032124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00032124 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatul... 75 4e-12 ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatul... 74 2e-11 gb|AFK45340.1| unknown [Medicago truncatula] 72 5e-11 ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_002533404.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatula] gi|357519903|ref|XP_003630240.1| Protein IDA-like protein [Medicago truncatula] gi|355524220|gb|AET04674.1| Protein IDA-like protein [Medicago truncatula] gi|355524262|gb|AET04716.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -2 Query: 118 SRNTNFFKVQPKSQHQGHFFGFLPKRMPIPYSSPSRKHN 2 SR TN FKV+PKS+HQGHFFGFLPKRM IPYS+PSRKHN Sbjct: 28 SRTTNDFKVKPKSEHQGHFFGFLPKRMHIPYSTPSRKHN 66 >ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatula] gi|355491609|gb|AES72812.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -2 Query: 118 SRNTNFFKVQPKSQHQGHFFGFLPKRMPIPYSSPSRKHN 2 SR TN FKV+PK +H+GHFFGFLP+R+PIPYSSPSRKHN Sbjct: 28 SRATNVFKVKPKYEHKGHFFGFLPRRIPIPYSSPSRKHN 66 >gb|AFK45340.1| unknown [Medicago truncatula] Length = 76 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 118 SRNTNFFKVQPKSQHQGHFFGFLPKRMPIPYSSPSRKHN 2 SR TN FKV+PK +H+GHFFGFLP R+PIPYSSPSRKHN Sbjct: 28 SRATNVFKVKPKYEHKGHFFGFLPGRIPIPYSSPSRKHN 66 >ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|222838042|gb|EEE76407.1| predicted protein [Populus trichocarpa] Length = 78 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = -2 Query: 118 SRNTNFFKVQPKSQHQGHFFGFLPKRMPIPYSSPSRKHN 2 SR+TN F +PK+Q++GHF FLP+ +PIP S PSR+HN Sbjct: 30 SRSTNVFNFKPKTQYKGHFLNFLPRHLPIPTSGPSRRHN 68 >ref|XP_002533404.1| conserved hypothetical protein [Ricinus communis] gi|223526749|gb|EEF28977.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/40 (62%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = -2 Query: 118 SRNT-NFFKVQPKSQHQGHFFGFLPKRMPIPYSSPSRKHN 2 SR T N F V+PK+QH+GHF FLP+ PIP S PSR+HN Sbjct: 38 SRTTANVFDVKPKNQHRGHFLNFLPRHFPIPTSGPSRRHN 77