BLASTX nr result
ID: Glycyrrhiza23_contig00031497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00031497 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK34828.1| unknown [Medicago truncatula] 83 2e-14 ref|XP_003605599.1| Apocytochrome f [Medicago truncatula] gi|355... 83 2e-14 ref|YP_003587784.1| envelope membrane protein [Lathyrus sativus]... 83 2e-14 gb|ADE42516.1| chloroplast envelope protein [Lathyrus odoratus] 83 2e-14 gb|ADE42511.1| chloroplast envelope protein [Lathyrus latifolius... 83 2e-14 >gb|AFK34828.1| unknown [Medicago truncatula] Length = 113 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +3 Query: 162 MAKKKVFIPLLCLTSIVFLPWGISFTFNKCMESWFTNWWNTK 287 MAKKK FIPLLCLTSIVFLPW ISFTF K +ESW TNWWNTK Sbjct: 1 MAKKKAFIPLLCLTSIVFLPWCISFTFKKSLESWITNWWNTK 42 >ref|XP_003605599.1| Apocytochrome f [Medicago truncatula] gi|355506654|gb|AES87796.1| Apocytochrome f [Medicago truncatula] Length = 543 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +3 Query: 162 MAKKKVFIPLLCLTSIVFLPWGISFTFNKCMESWFTNWWNTK 287 MAKKK FIPLLCLTSIVFLPW ISFTF K +ESW TNWWNTK Sbjct: 1 MAKKKAFIPLLCLTSIVFLPWCISFTFKKSLESWITNWWNTK 42 >ref|YP_003587784.1| envelope membrane protein [Lathyrus sativus] gi|293338673|gb|ADE43645.1| envelope membrane protein (chloroplast) [Lathyrus sativus] Length = 231 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +3 Query: 162 MAKKKVFIPLLCLTSIVFLPWGISFTFNKCMESWFTNWWNTK 287 MAKKK FIPLLCLTSIVFLPW ISFTF K +ESW TNWWNTK Sbjct: 1 MAKKKAFIPLLCLTSIVFLPWCISFTFKKSLESWITNWWNTK 42 >gb|ADE42516.1| chloroplast envelope protein [Lathyrus odoratus] Length = 210 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +3 Query: 162 MAKKKVFIPLLCLTSIVFLPWGISFTFNKCMESWFTNWWNTK 287 MAKKK FIPLLCLTSIVFLPW ISFTF K +ESW TNWWNTK Sbjct: 1 MAKKKTFIPLLCLTSIVFLPWCISFTFKKSLESWITNWWNTK 42 >gb|ADE42511.1| chloroplast envelope protein [Lathyrus latifolius] gi|292806839|gb|ADE42514.1| chloroplast envelope protein [Lathyrus cirrhosus] Length = 210 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +3 Query: 162 MAKKKVFIPLLCLTSIVFLPWGISFTFNKCMESWFTNWWNTK 287 MAKKK FIPLLCLTSIVFLPW ISFTF K +ESW TNWWNTK Sbjct: 1 MAKKKAFIPLLCLTSIVFLPWCISFTFKKSLESWITNWWNTK 42